Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A364N9L0

Protein Details
Accession A0A364N9L0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
43-68ADSADPTGENRRRRRRRIPEGEAGEDBasic
282-302EGYVQKKERFMKEQKEWDREEAcidic
NLS Segment(s)
PositionSequence
53-60RRRRRRRI
Subcellular Location(s) mito 13.5, cyto_mito 7.5, nucl 3, plas 3, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025494  DUF4385  
Pfam View protein in Pfam  
PF14328  DUF4385  
Amino Acid Sequences MPPHLHPRSRMTTSLFTSTLMISFLVVAAPHILPCPVDPRTLADSADPTGENRRRRRRRIPEGEAGEDAMSEERRRRQLIAERLAAKRECPVPKPGGLIGQVLGVNDEEKEEQPSSIMQRGARTNTPIFSIPNLMANRHFPTNTEQSITAMPTESLTKAQRMSYRIGRGETGVLTFEPYKSSILPLWRFKNPSIARKSSSEIYKRFLEYNDQDDFIGMDMSRKFLQMGMTRAKRYANHAGGRKYDKKTGEQLEKSKGHEGMEEKLEASEAFREVWEKAKAHEGYVQKKERFMKEQKEWDREEKNEAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.46
3 0.38
4 0.35
5 0.31
6 0.25
7 0.19
8 0.15
9 0.09
10 0.09
11 0.08
12 0.07
13 0.06
14 0.06
15 0.08
16 0.08
17 0.08
18 0.09
19 0.09
20 0.09
21 0.1
22 0.16
23 0.15
24 0.16
25 0.17
26 0.22
27 0.26
28 0.27
29 0.26
30 0.22
31 0.23
32 0.22
33 0.23
34 0.18
35 0.15
36 0.24
37 0.3
38 0.37
39 0.46
40 0.56
41 0.65
42 0.74
43 0.84
44 0.85
45 0.9
46 0.92
47 0.9
48 0.89
49 0.84
50 0.78
51 0.67
52 0.57
53 0.45
54 0.34
55 0.26
56 0.18
57 0.13
58 0.11
59 0.15
60 0.2
61 0.25
62 0.27
63 0.28
64 0.34
65 0.42
66 0.5
67 0.52
68 0.53
69 0.54
70 0.53
71 0.57
72 0.49
73 0.4
74 0.35
75 0.35
76 0.33
77 0.3
78 0.35
79 0.34
80 0.35
81 0.37
82 0.34
83 0.3
84 0.27
85 0.25
86 0.19
87 0.17
88 0.15
89 0.12
90 0.12
91 0.08
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.1
98 0.1
99 0.1
100 0.1
101 0.12
102 0.14
103 0.16
104 0.18
105 0.16
106 0.19
107 0.22
108 0.25
109 0.25
110 0.26
111 0.24
112 0.22
113 0.23
114 0.21
115 0.18
116 0.16
117 0.16
118 0.12
119 0.18
120 0.17
121 0.16
122 0.16
123 0.18
124 0.2
125 0.19
126 0.19
127 0.14
128 0.19
129 0.23
130 0.23
131 0.21
132 0.19
133 0.19
134 0.2
135 0.19
136 0.14
137 0.09
138 0.08
139 0.07
140 0.08
141 0.07
142 0.09
143 0.09
144 0.11
145 0.11
146 0.14
147 0.17
148 0.19
149 0.22
150 0.25
151 0.29
152 0.3
153 0.3
154 0.28
155 0.25
156 0.23
157 0.19
158 0.14
159 0.1
160 0.08
161 0.08
162 0.08
163 0.08
164 0.08
165 0.08
166 0.09
167 0.09
168 0.1
169 0.11
170 0.17
171 0.22
172 0.28
173 0.31
174 0.35
175 0.37
176 0.36
177 0.44
178 0.43
179 0.47
180 0.47
181 0.47
182 0.46
183 0.46
184 0.49
185 0.44
186 0.46
187 0.44
188 0.39
189 0.39
190 0.4
191 0.39
192 0.37
193 0.33
194 0.33
195 0.29
196 0.32
197 0.29
198 0.27
199 0.25
200 0.23
201 0.22
202 0.15
203 0.13
204 0.08
205 0.09
206 0.08
207 0.11
208 0.11
209 0.12
210 0.11
211 0.12
212 0.18
213 0.19
214 0.24
215 0.31
216 0.36
217 0.37
218 0.38
219 0.4
220 0.36
221 0.39
222 0.44
223 0.42
224 0.44
225 0.5
226 0.52
227 0.56
228 0.63
229 0.63
230 0.58
231 0.57
232 0.53
233 0.52
234 0.56
235 0.58
236 0.6
237 0.6
238 0.61
239 0.64
240 0.64
241 0.62
242 0.58
243 0.51
244 0.42
245 0.39
246 0.36
247 0.32
248 0.31
249 0.29
250 0.24
251 0.22
252 0.22
253 0.17
254 0.16
255 0.13
256 0.1
257 0.1
258 0.1
259 0.12
260 0.13
261 0.19
262 0.23
263 0.22
264 0.23
265 0.32
266 0.32
267 0.32
268 0.38
269 0.4
270 0.43
271 0.52
272 0.6
273 0.52
274 0.58
275 0.64
276 0.65
277 0.67
278 0.67
279 0.68
280 0.69
281 0.78
282 0.8
283 0.81
284 0.79
285 0.79
286 0.77
287 0.7
288 0.68