Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A364N284

Protein Details
Accession A0A364N284   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-43ATTAPELSRKKSKKDKSKKLSKSAAVDATHydrophilic
64-93DEKLSKAERKAAKKAKKEAKEAKKAKKAAVBasic
NLS Segment(s)
PositionSequence
23-35RKKSKKDKSKKLS
69-91KAERKAAKKAKKEAKEAKKAKKA
114-131AEKAARKAEKKRLKALAK
Subcellular Location(s) cyto_nucl 12, nucl 10.5, cyto 10.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
IPR000629  RNA-helicase_DEAD-box_CS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004386  F:helicase activity  
GO:0003676  F:nucleic acid binding  
GO:0017111  F:ribonucleoside triphosphate phosphatase activity  
Pfam View protein in Pfam  
PF00270  DEAD  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS00039  DEAD_ATP_HELICASE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
CDD cd00268  DEADc  
cd18787  SF2_C_DEAD  
Amino Acid Sequences MAKRPISDVVAEDGATTAPELSRKKSKKDKSKKLSKSAAVDATETNGHTEDATNGNSVEDSESDEKLSKAERKAAKKAKKEAKEAKKAKKAAVEAEAEDSNGAAIEDEEAVKAAEKAARKAEKKRLKALAKGEEAAEAAPSSKPAPVAAKVEATATGETGAEPASYEESNELTQLPQSEVDAFLAKNTMAIVDPKPTARKLRPILDFKYLPVDDTQRAFFAKFTTPTPIQAATWPFLLSGRDMVGVAETGSGKTLAFGVPCVRYISSLPKNERKGIKAVIVSPTRELAVQIYDQLVALATPAGLSVVCVYGGVPKDPQVAACRKAHIVVATPGRLNDLIGDGSADLSKADYVVLDEADRMLDKGFEEAIRQIISQTPKKRQTLMFTATWPQSVRDLASTFMSSPVKITIGDNQSGELRANVRIKQLVEVVDPRAKEQRLLQLLKQYQSGKNKDDRILVFCLYKKEAVRIENFIRIKGFRVGGIHGDLSQEKRSASLAAFKEGHVPLLVATDVAARGLDIPAVKVVINVTFPLTAEDYVHRIGRTGRAGKEGLAITLFTEHDKALSGSLINVLKAANQPVPEELMKFGTTVKKKEHGAYGAFYKDTDNTKAATKITFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.11
4 0.08
5 0.07
6 0.14
7 0.17
8 0.23
9 0.34
10 0.4
11 0.5
12 0.6
13 0.7
14 0.75
15 0.83
16 0.88
17 0.89
18 0.94
19 0.94
20 0.94
21 0.93
22 0.89
23 0.84
24 0.81
25 0.76
26 0.66
27 0.58
28 0.48
29 0.41
30 0.35
31 0.28
32 0.22
33 0.16
34 0.15
35 0.13
36 0.14
37 0.14
38 0.15
39 0.16
40 0.15
41 0.15
42 0.15
43 0.14
44 0.14
45 0.13
46 0.1
47 0.15
48 0.16
49 0.17
50 0.18
51 0.19
52 0.19
53 0.19
54 0.25
55 0.26
56 0.28
57 0.36
58 0.43
59 0.49
60 0.6
61 0.69
62 0.72
63 0.75
64 0.81
65 0.83
66 0.83
67 0.85
68 0.85
69 0.86
70 0.87
71 0.88
72 0.88
73 0.87
74 0.83
75 0.78
76 0.74
77 0.67
78 0.62
79 0.58
80 0.5
81 0.42
82 0.41
83 0.36
84 0.29
85 0.25
86 0.19
87 0.13
88 0.09
89 0.08
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.08
101 0.11
102 0.13
103 0.16
104 0.25
105 0.33
106 0.38
107 0.47
108 0.56
109 0.63
110 0.67
111 0.73
112 0.74
113 0.72
114 0.74
115 0.73
116 0.72
117 0.65
118 0.6
119 0.51
120 0.42
121 0.36
122 0.29
123 0.2
124 0.11
125 0.09
126 0.08
127 0.08
128 0.08
129 0.09
130 0.09
131 0.11
132 0.14
133 0.16
134 0.2
135 0.2
136 0.21
137 0.2
138 0.2
139 0.19
140 0.17
141 0.14
142 0.11
143 0.1
144 0.08
145 0.08
146 0.08
147 0.07
148 0.05
149 0.05
150 0.06
151 0.08
152 0.07
153 0.08
154 0.08
155 0.1
156 0.1
157 0.1
158 0.1
159 0.08
160 0.09
161 0.1
162 0.1
163 0.09
164 0.1
165 0.1
166 0.1
167 0.11
168 0.11
169 0.1
170 0.09
171 0.09
172 0.08
173 0.08
174 0.07
175 0.07
176 0.06
177 0.09
178 0.09
179 0.12
180 0.13
181 0.15
182 0.18
183 0.21
184 0.28
185 0.29
186 0.37
187 0.4
188 0.47
189 0.53
190 0.56
191 0.57
192 0.57
193 0.54
194 0.45
195 0.47
196 0.38
197 0.31
198 0.27
199 0.27
200 0.21
201 0.23
202 0.23
203 0.16
204 0.17
205 0.16
206 0.15
207 0.14
208 0.16
209 0.16
210 0.16
211 0.22
212 0.21
213 0.23
214 0.25
215 0.23
216 0.19
217 0.21
218 0.22
219 0.17
220 0.17
221 0.15
222 0.13
223 0.13
224 0.13
225 0.1
226 0.08
227 0.08
228 0.07
229 0.07
230 0.07
231 0.06
232 0.06
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.06
242 0.05
243 0.05
244 0.06
245 0.08
246 0.09
247 0.1
248 0.11
249 0.1
250 0.11
251 0.12
252 0.2
253 0.25
254 0.31
255 0.36
256 0.42
257 0.45
258 0.5
259 0.52
260 0.45
261 0.43
262 0.38
263 0.37
264 0.31
265 0.3
266 0.3
267 0.29
268 0.27
269 0.24
270 0.22
271 0.18
272 0.16
273 0.15
274 0.09
275 0.08
276 0.07
277 0.07
278 0.07
279 0.07
280 0.07
281 0.06
282 0.05
283 0.04
284 0.04
285 0.03
286 0.02
287 0.02
288 0.02
289 0.02
290 0.02
291 0.03
292 0.03
293 0.03
294 0.03
295 0.03
296 0.03
297 0.06
298 0.07
299 0.08
300 0.07
301 0.08
302 0.1
303 0.1
304 0.11
305 0.14
306 0.17
307 0.2
308 0.21
309 0.22
310 0.2
311 0.21
312 0.21
313 0.17
314 0.15
315 0.16
316 0.17
317 0.17
318 0.17
319 0.16
320 0.16
321 0.15
322 0.13
323 0.09
324 0.07
325 0.06
326 0.06
327 0.06
328 0.05
329 0.05
330 0.05
331 0.05
332 0.03
333 0.04
334 0.04
335 0.03
336 0.03
337 0.03
338 0.04
339 0.04
340 0.05
341 0.04
342 0.05
343 0.05
344 0.05
345 0.05
346 0.05
347 0.04
348 0.05
349 0.05
350 0.05
351 0.06
352 0.06
353 0.07
354 0.07
355 0.09
356 0.09
357 0.09
358 0.08
359 0.12
360 0.17
361 0.23
362 0.29
363 0.36
364 0.43
365 0.45
366 0.5
367 0.49
368 0.5
369 0.51
370 0.49
371 0.42
372 0.37
373 0.39
374 0.35
375 0.34
376 0.28
377 0.21
378 0.18
379 0.16
380 0.15
381 0.13
382 0.13
383 0.12
384 0.13
385 0.13
386 0.11
387 0.15
388 0.15
389 0.12
390 0.12
391 0.12
392 0.12
393 0.12
394 0.12
395 0.15
396 0.18
397 0.2
398 0.19
399 0.19
400 0.19
401 0.2
402 0.19
403 0.13
404 0.11
405 0.15
406 0.18
407 0.19
408 0.2
409 0.23
410 0.23
411 0.24
412 0.25
413 0.21
414 0.2
415 0.2
416 0.22
417 0.22
418 0.21
419 0.22
420 0.26
421 0.24
422 0.24
423 0.25
424 0.3
425 0.35
426 0.38
427 0.38
428 0.41
429 0.45
430 0.44
431 0.46
432 0.41
433 0.39
434 0.46
435 0.49
436 0.46
437 0.49
438 0.53
439 0.52
440 0.54
441 0.49
442 0.45
443 0.43
444 0.39
445 0.35
446 0.32
447 0.32
448 0.28
449 0.29
450 0.26
451 0.28
452 0.31
453 0.32
454 0.33
455 0.35
456 0.36
457 0.41
458 0.4
459 0.36
460 0.34
461 0.31
462 0.3
463 0.29
464 0.26
465 0.2
466 0.21
467 0.21
468 0.21
469 0.23
470 0.2
471 0.16
472 0.17
473 0.17
474 0.18
475 0.19
476 0.18
477 0.16
478 0.16
479 0.17
480 0.17
481 0.16
482 0.21
483 0.2
484 0.25
485 0.26
486 0.25
487 0.31
488 0.29
489 0.29
490 0.21
491 0.19
492 0.13
493 0.14
494 0.14
495 0.07
496 0.07
497 0.07
498 0.07
499 0.07
500 0.07
501 0.05
502 0.06
503 0.06
504 0.08
505 0.07
506 0.08
507 0.08
508 0.09
509 0.09
510 0.09
511 0.1
512 0.1
513 0.1
514 0.1
515 0.11
516 0.11
517 0.11
518 0.13
519 0.14
520 0.13
521 0.14
522 0.15
523 0.16
524 0.18
525 0.21
526 0.18
527 0.18
528 0.2
529 0.25
530 0.31
531 0.35
532 0.34
533 0.37
534 0.38
535 0.37
536 0.4
537 0.35
538 0.27
539 0.21
540 0.19
541 0.14
542 0.16
543 0.16
544 0.11
545 0.12
546 0.11
547 0.11
548 0.12
549 0.12
550 0.11
551 0.12
552 0.11
553 0.1
554 0.16
555 0.16
556 0.15
557 0.15
558 0.14
559 0.15
560 0.18
561 0.21
562 0.19
563 0.19
564 0.2
565 0.21
566 0.26
567 0.24
568 0.23
569 0.21
570 0.21
571 0.2
572 0.19
573 0.22
574 0.27
575 0.31
576 0.36
577 0.41
578 0.44
579 0.48
580 0.53
581 0.57
582 0.54
583 0.51
584 0.51
585 0.5
586 0.47
587 0.43
588 0.38
589 0.32
590 0.31
591 0.32
592 0.31
593 0.27
594 0.25
595 0.29
596 0.32
597 0.32