FuNGI

A0A364MWS1

Protein Details

Accession

A0A364MWS1

Localization Confidence

Low

Confidence Score

8.8

NoLS Segment(s)

Position	Sequence	Protein Nature
50-69	QRETPKSVPRNEPKGRRDES	Basic

NLS Segment(s)

Subcellular Location(s)

nucl 13.5, cyto_nucl 10.5, cyto 6.5, mito 5

Family & Domain DBs

InterPro	View protein in InterPro IPR043502 DNA/RNA_pol_sf IPR032567 LDOC1-rel IPR000477 RT_dom
Gene Ontology	GO:0003964 F:RNA-directed DNA polymerase activity
Pfam	View protein in Pfam PF00078 RVT_1
CDD	cd01647 RT_LTR

Amino Acid Sequences

MSSSRNTRGKQAARRATDTSPDRDRSVANRPAIEQQAQRETTTQEDELLQRETPKSVPRNEPKGRRDESEDSSKREASDPENSPGTPQSEEGQPLRNPLLNHGKARSALPIRSHQPAAGDANPYCTQSAMELRAAHMHHDNAAATGTTIPSQDRTGNNDNGATHGTTYGPSPDDDEAKIAFVWAKIPDIIRREMQRHGGFETIHTWIDFERALRNAETANCTVIAPSLSQNGFSVSVGRRDAEEQHSPDPPTPQLGLSGDEIRDDKWYDRRGILWVRTWVNRTKAHLEKCIADALDLVPPHKGRSLPDGEESLPEFQLASDKPDPEELKHVLEIEEGKKIPNLLIYNLSGRELEILREYLAAAQEKGWIRPSKSLVRAPILFVLKSDGTMRLCVDYRGLNKVTIKDRYPIPLVSEMLDRLSKAAIYTKLDLRDAYYRLRVCEGDEWKTAFKTRYGHYEYNVMLFGLANAPATFQSYVH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.76
2	0.72
3	0.66
4	0.66
5	0.61
6	0.58
7	0.56
8	0.54
9	0.5
10	0.48
11	0.47
12	0.43
13	0.48
14	0.48
15	0.44
16	0.43
17	0.43
18	0.48
19	0.5
20	0.5
21	0.44
22	0.42
23	0.47
24	0.46
25	0.44
26	0.4
27	0.37
28	0.36
29	0.36
30	0.3
31	0.23
32	0.24
33	0.25
34	0.26
35	0.26
36	0.23
37	0.22
38	0.23
39	0.24
40	0.24
41	0.31
42	0.35
43	0.41
44	0.5
45	0.56
46	0.66
47	0.73
48	0.79
49	0.78
50	0.81
51	0.77
52	0.71
53	0.69
54	0.65
55	0.62
56	0.63
57	0.61
58	0.57
59	0.57
60	0.54
61	0.47
62	0.44
63	0.4
64	0.34
65	0.39
66	0.37
67	0.37
68	0.38
69	0.36
70	0.35
71	0.35
72	0.32
73	0.24
74	0.22
75	0.2
76	0.2
77	0.24
78	0.24
79	0.28
80	0.26
81	0.28
82	0.3
83	0.3
84	0.27
85	0.31
86	0.4
87	0.38
88	0.41
89	0.39
90	0.4
91	0.38
92	0.39
93	0.39
94	0.33
95	0.32
96	0.33
97	0.38
98	0.38
99	0.41
100	0.41
101	0.34
102	0.31
103	0.3
104	0.3
105	0.26
106	0.26
107	0.21
108	0.26
109	0.26
110	0.26
111	0.22
112	0.18
113	0.16
114	0.15
115	0.19
116	0.16
117	0.18
118	0.17
119	0.18
120	0.22
121	0.22
122	0.22
123	0.2
124	0.18
125	0.16
126	0.17
127	0.16
128	0.12
129	0.13
130	0.1
131	0.08
132	0.08
133	0.07
134	0.07
135	0.07
136	0.07
137	0.08
138	0.1
139	0.14
140	0.16
141	0.23
142	0.28
143	0.3
144	0.31
145	0.31
146	0.29
147	0.26
148	0.26
149	0.19
150	0.13
151	0.11
152	0.1
153	0.09
154	0.09
155	0.1
156	0.09
157	0.09
158	0.11
159	0.11
160	0.13
161	0.13
162	0.14
163	0.12
164	0.12
165	0.12
166	0.09
167	0.09
168	0.07
169	0.09
170	0.08
171	0.09
172	0.09
173	0.1
174	0.14
175	0.16
176	0.19
177	0.2
178	0.24
179	0.25
180	0.27
181	0.34
182	0.33
183	0.31
184	0.3
185	0.29
186	0.25
187	0.23
188	0.23
189	0.17
190	0.14
191	0.13
192	0.11
193	0.09
194	0.1
195	0.1
196	0.08
197	0.09
198	0.1
199	0.12
200	0.12
201	0.12
202	0.12
203	0.13
204	0.15
205	0.13
206	0.12
207	0.11
208	0.11
209	0.1
210	0.1
211	0.09
212	0.07
213	0.07
214	0.1
215	0.09
216	0.1
217	0.1
218	0.1
219	0.1
220	0.1
221	0.12
222	0.1
223	0.12
224	0.13
225	0.13
226	0.12
227	0.13
228	0.16
229	0.17
230	0.21
231	0.2
232	0.22
233	0.25
234	0.25
235	0.25
236	0.24
237	0.2
238	0.17
239	0.15
240	0.13
241	0.12
242	0.12
243	0.13
244	0.12
245	0.13
246	0.11
247	0.12
248	0.12
249	0.11
250	0.11
251	0.11
252	0.12
253	0.16
254	0.2
255	0.21
256	0.21
257	0.22
258	0.25
259	0.29
260	0.3
261	0.28
262	0.29
263	0.3
264	0.32
265	0.34
266	0.34
267	0.34
268	0.35
269	0.35
270	0.38
271	0.42
272	0.43
273	0.46
274	0.43
275	0.39
276	0.37
277	0.35
278	0.28
279	0.21
280	0.17
281	0.12
282	0.13
283	0.12
284	0.11
285	0.11
286	0.11
287	0.12
288	0.14
289	0.14
290	0.13
291	0.2
292	0.25
293	0.24
294	0.26
295	0.28
296	0.26
297	0.26
298	0.26
299	0.2
300	0.15
301	0.13
302	0.11
303	0.09
304	0.12
305	0.11
306	0.16
307	0.17
308	0.18
309	0.19
310	0.24
311	0.26
312	0.23
313	0.29
314	0.24
315	0.23
316	0.24
317	0.23
318	0.18
319	0.18
320	0.2
321	0.16
322	0.19
323	0.16
324	0.16
325	0.17
326	0.17
327	0.16
328	0.17
329	0.17
330	0.14
331	0.17
332	0.18
333	0.2
334	0.2
335	0.21
336	0.16
337	0.14
338	0.15
339	0.13
340	0.12
341	0.12
342	0.12
343	0.11
344	0.11
345	0.12
346	0.1
347	0.13
348	0.13
349	0.11
350	0.11
351	0.16
352	0.18
353	0.19
354	0.24
355	0.26
356	0.27
357	0.33
358	0.39
359	0.41
360	0.47
361	0.5
362	0.48
363	0.5
364	0.49
365	0.45
366	0.45
367	0.39
368	0.32
369	0.27
370	0.27
371	0.21
372	0.21
373	0.2
374	0.18
375	0.17
376	0.18
377	0.19
378	0.18
379	0.19
380	0.18
381	0.19
382	0.21
383	0.22
384	0.27
385	0.28
386	0.28
387	0.31
388	0.37
389	0.42
390	0.42
391	0.42
392	0.4
393	0.42
394	0.43
395	0.43
396	0.38
397	0.35
398	0.34
399	0.33
400	0.3
401	0.29
402	0.24
403	0.23
404	0.23
405	0.18
406	0.14
407	0.14
408	0.13
409	0.11
410	0.17
411	0.18
412	0.22
413	0.26
414	0.3
415	0.33
416	0.34
417	0.33
418	0.31
419	0.34
420	0.32
421	0.33
422	0.36
423	0.35
424	0.36
425	0.39
426	0.35
427	0.33
428	0.39
429	0.39
430	0.37
431	0.39
432	0.4
433	0.39
434	0.41
435	0.42
436	0.36
437	0.35
438	0.36
439	0.35
440	0.42
441	0.47
442	0.49
443	0.46
444	0.51
445	0.47
446	0.44
447	0.41
448	0.31
449	0.23
450	0.19
451	0.17
452	0.12
453	0.11
454	0.1
455	0.09
456	0.1
457	0.1
458	0.13

A0A364MWS1

3D AlphaFold-predicted Structure Viewer