Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1DMB1

Protein Details
Accession A1DMB1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-92RSTERVYHARRPHRKSRSGCLTCKRRRVKTQTPLLMHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
KEGG nfi:NFIA_052780  -  
Amino Acid Sequences MLPSPETSVSPEAAEKTRSKTNPKHSGPSGPLQGQKSLFRVPMYRAAGTGQSNSERSTERVYHARRPHRKSRSGCLTCKRRRVKTQTPLLMHTIIAVATSHLRYVVPDNTAYKMAEAYHWQQAISQYSKELGCAVGPHNMDALFSTCLLMTVHAFQLEEYNPRKSFVFSDDPQALSWLTLQGGLRHLLGLTKPWLCISMWWEVFMASRHENQAFEDPPPGREGLHPELADICGIDDTTTEESNPYLAPLRMLTLLLPAERSIKSFSKYTTFMGRLLPSFWAQLAKKDPPALIILSWWLAMLDSCRCWWAETRVRSECAAICMYLEDSEDPRILRLLEFPAEVCGYLLRHVQERAEIEVPLIMPYEPVGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.31
4 0.39
5 0.43
6 0.51
7 0.57
8 0.64
9 0.7
10 0.74
11 0.77
12 0.72
13 0.75
14 0.71
15 0.69
16 0.65
17 0.59
18 0.59
19 0.52
20 0.53
21 0.47
22 0.46
23 0.42
24 0.39
25 0.36
26 0.33
27 0.34
28 0.33
29 0.39
30 0.39
31 0.36
32 0.32
33 0.31
34 0.33
35 0.31
36 0.3
37 0.24
38 0.23
39 0.24
40 0.25
41 0.26
42 0.23
43 0.24
44 0.28
45 0.27
46 0.28
47 0.37
48 0.41
49 0.47
50 0.55
51 0.63
52 0.67
53 0.72
54 0.79
55 0.8
56 0.84
57 0.81
58 0.82
59 0.83
60 0.8
61 0.81
62 0.8
63 0.81
64 0.8
65 0.84
66 0.83
67 0.81
68 0.84
69 0.85
70 0.85
71 0.85
72 0.86
73 0.85
74 0.79
75 0.73
76 0.66
77 0.56
78 0.45
79 0.35
80 0.25
81 0.16
82 0.12
83 0.09
84 0.06
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.09
91 0.13
92 0.15
93 0.15
94 0.17
95 0.18
96 0.2
97 0.21
98 0.2
99 0.17
100 0.14
101 0.13
102 0.12
103 0.15
104 0.16
105 0.19
106 0.19
107 0.19
108 0.2
109 0.22
110 0.26
111 0.24
112 0.21
113 0.17
114 0.19
115 0.19
116 0.17
117 0.15
118 0.1
119 0.08
120 0.1
121 0.1
122 0.13
123 0.13
124 0.13
125 0.13
126 0.13
127 0.13
128 0.12
129 0.12
130 0.08
131 0.08
132 0.08
133 0.07
134 0.08
135 0.08
136 0.07
137 0.06
138 0.07
139 0.07
140 0.07
141 0.08
142 0.07
143 0.09
144 0.1
145 0.15
146 0.16
147 0.2
148 0.2
149 0.21
150 0.22
151 0.2
152 0.21
153 0.21
154 0.25
155 0.21
156 0.26
157 0.26
158 0.26
159 0.25
160 0.25
161 0.19
162 0.12
163 0.12
164 0.07
165 0.06
166 0.07
167 0.07
168 0.07
169 0.09
170 0.09
171 0.09
172 0.08
173 0.08
174 0.07
175 0.07
176 0.08
177 0.09
178 0.09
179 0.09
180 0.09
181 0.11
182 0.1
183 0.11
184 0.12
185 0.16
186 0.15
187 0.16
188 0.16
189 0.15
190 0.16
191 0.16
192 0.16
193 0.11
194 0.13
195 0.14
196 0.15
197 0.15
198 0.16
199 0.2
200 0.18
201 0.17
202 0.2
203 0.19
204 0.19
205 0.2
206 0.18
207 0.14
208 0.14
209 0.2
210 0.19
211 0.23
212 0.22
213 0.21
214 0.22
215 0.21
216 0.2
217 0.13
218 0.09
219 0.05
220 0.05
221 0.04
222 0.04
223 0.06
224 0.08
225 0.08
226 0.08
227 0.09
228 0.09
229 0.1
230 0.09
231 0.08
232 0.08
233 0.08
234 0.09
235 0.09
236 0.1
237 0.1
238 0.1
239 0.09
240 0.09
241 0.1
242 0.1
243 0.1
244 0.09
245 0.12
246 0.12
247 0.13
248 0.16
249 0.18
250 0.2
251 0.22
252 0.24
253 0.25
254 0.27
255 0.28
256 0.31
257 0.3
258 0.29
259 0.3
260 0.3
261 0.26
262 0.25
263 0.25
264 0.18
265 0.17
266 0.16
267 0.19
268 0.17
269 0.22
270 0.27
271 0.29
272 0.31
273 0.33
274 0.32
275 0.28
276 0.3
277 0.25
278 0.19
279 0.16
280 0.14
281 0.12
282 0.12
283 0.1
284 0.08
285 0.06
286 0.07
287 0.08
288 0.1
289 0.1
290 0.11
291 0.12
292 0.13
293 0.14
294 0.19
295 0.26
296 0.33
297 0.38
298 0.46
299 0.5
300 0.52
301 0.51
302 0.49
303 0.42
304 0.36
305 0.31
306 0.22
307 0.18
308 0.17
309 0.17
310 0.14
311 0.13
312 0.11
313 0.12
314 0.14
315 0.16
316 0.15
317 0.15
318 0.16
319 0.15
320 0.14
321 0.16
322 0.17
323 0.18
324 0.18
325 0.18
326 0.2
327 0.19
328 0.18
329 0.16
330 0.13
331 0.12
332 0.14
333 0.17
334 0.16
335 0.2
336 0.21
337 0.22
338 0.26
339 0.28
340 0.31
341 0.29
342 0.27
343 0.23
344 0.24
345 0.23
346 0.18
347 0.17
348 0.11
349 0.09