Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0P0K2

Protein Details
Accession A0A2X0P0K2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-100SGVRGPGPPRNKKKKTEHNPNRSQQTNHydrophilic
NLS Segment(s)
PositionSequence
77-89RGPGPPRNKKKKT
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MGITGINRPSVRSASDTGTSDLEEEEVLATRNRTLVPKKRGARQGAGSPQLSQDTQQTSPHVGSSGQRSTPAASGVRGPGPPRNKKKKTEHNPNRSQQTNPKRDLGNGRAEEEEDEDQGQDEEEVEELERSPRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.3
4 0.28
5 0.27
6 0.25
7 0.21
8 0.18
9 0.14
10 0.1
11 0.08
12 0.07
13 0.06
14 0.07
15 0.08
16 0.08
17 0.08
18 0.1
19 0.11
20 0.16
21 0.24
22 0.33
23 0.4
24 0.49
25 0.53
26 0.6
27 0.67
28 0.66
29 0.63
30 0.58
31 0.58
32 0.55
33 0.54
34 0.46
35 0.39
36 0.35
37 0.31
38 0.26
39 0.19
40 0.16
41 0.15
42 0.16
43 0.17
44 0.17
45 0.17
46 0.17
47 0.16
48 0.14
49 0.11
50 0.11
51 0.15
52 0.16
53 0.14
54 0.15
55 0.15
56 0.16
57 0.16
58 0.16
59 0.12
60 0.1
61 0.11
62 0.12
63 0.13
64 0.13
65 0.13
66 0.18
67 0.26
68 0.35
69 0.45
70 0.55
71 0.6
72 0.68
73 0.78
74 0.83
75 0.85
76 0.87
77 0.88
78 0.87
79 0.9
80 0.89
81 0.86
82 0.77
83 0.71
84 0.7
85 0.7
86 0.68
87 0.61
88 0.59
89 0.52
90 0.54
91 0.58
92 0.53
93 0.52
94 0.45
95 0.44
96 0.4
97 0.39
98 0.35
99 0.3
100 0.26
101 0.18
102 0.16
103 0.14
104 0.13
105 0.13
106 0.12
107 0.08
108 0.08
109 0.07
110 0.06
111 0.07
112 0.07
113 0.08
114 0.08