Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0MN88

Protein Details
Accession A0A2X0MN88    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
62-82QEMGKNSGKARKKKRTEDPQRBasic
NLS Segment(s)
PositionSequence
68-77SGKARKKKRT
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MEDLTIKRSSDMVASKMKRHSGIRTASQNTLSDHTMQAVCSEVIDDPANNLRFSSRVADAIQEMGKNSGKARKKKRTEDPQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.41
4 0.44
5 0.43
6 0.43
7 0.44
8 0.43
9 0.46
10 0.47
11 0.51
12 0.51
13 0.48
14 0.47
15 0.42
16 0.36
17 0.33
18 0.27
19 0.2
20 0.17
21 0.16
22 0.14
23 0.13
24 0.11
25 0.1
26 0.08
27 0.07
28 0.07
29 0.05
30 0.07
31 0.07
32 0.06
33 0.07
34 0.12
35 0.14
36 0.13
37 0.13
38 0.12
39 0.13
40 0.14
41 0.17
42 0.12
43 0.13
44 0.14
45 0.15
46 0.15
47 0.17
48 0.17
49 0.14
50 0.13
51 0.14
52 0.16
53 0.16
54 0.18
55 0.24
56 0.32
57 0.42
58 0.52
59 0.6
60 0.68
61 0.78
62 0.86