Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0PHW8

Protein Details
Accession A0A2X0PHW8    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-99LLDRQCSSRRKPARTKKLTDRASLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026635  Efm4/METTL10  
IPR025714  Methyltranfer_dom  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016279  F:protein-lysine N-methyltransferase activity  
GO:0018022  P:peptidyl-lysine methylation  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF13847  Methyltransf_31  
Amino Acid Sequences MPGPSLQDAVSWLAAHADEAPALGAPLHPSKLGTKQHWDELITCFADQGEVWFGEDAADKMVEWIQEHVPQTDANLLDRQCSSRRKPARTKKLTDRASLFPYLWGAVGTGNGQLLFRLSEEGYTSLTGIDYSLSSIELAESILSSTTQHPKPSINFFVSDILSPDPDPRLTQKRWKVLLDKGTYDAICLSDQVDPKEGVRIGELYPKAVAGWLDEEAYLLITSCNWTRAELEKAFITPQTGLIFHSLVPRPSFSFGGSTGSSITTIAFQKKKTQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.08
5 0.07
6 0.07
7 0.07
8 0.06
9 0.06
10 0.06
11 0.06
12 0.09
13 0.12
14 0.13
15 0.13
16 0.15
17 0.18
18 0.27
19 0.34
20 0.36
21 0.42
22 0.45
23 0.51
24 0.52
25 0.51
26 0.44
27 0.4
28 0.39
29 0.31
30 0.27
31 0.21
32 0.18
33 0.16
34 0.14
35 0.12
36 0.1
37 0.09
38 0.1
39 0.1
40 0.1
41 0.1
42 0.11
43 0.1
44 0.08
45 0.08
46 0.07
47 0.08
48 0.1
49 0.09
50 0.09
51 0.12
52 0.12
53 0.17
54 0.18
55 0.18
56 0.17
57 0.16
58 0.16
59 0.18
60 0.16
61 0.14
62 0.17
63 0.16
64 0.17
65 0.18
66 0.21
67 0.23
68 0.3
69 0.33
70 0.39
71 0.48
72 0.55
73 0.66
74 0.74
75 0.79
76 0.81
77 0.84
78 0.85
79 0.86
80 0.82
81 0.76
82 0.7
83 0.62
84 0.57
85 0.5
86 0.39
87 0.3
88 0.25
89 0.2
90 0.15
91 0.11
92 0.07
93 0.06
94 0.06
95 0.06
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.06
106 0.06
107 0.07
108 0.08
109 0.08
110 0.08
111 0.08
112 0.06
113 0.06
114 0.06
115 0.05
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.07
133 0.13
134 0.15
135 0.16
136 0.17
137 0.2
138 0.23
139 0.28
140 0.29
141 0.24
142 0.24
143 0.24
144 0.25
145 0.23
146 0.2
147 0.15
148 0.12
149 0.11
150 0.1
151 0.1
152 0.09
153 0.09
154 0.1
155 0.15
156 0.22
157 0.25
158 0.34
159 0.41
160 0.48
161 0.52
162 0.55
163 0.54
164 0.53
165 0.58
166 0.52
167 0.46
168 0.4
169 0.38
170 0.34
171 0.29
172 0.23
173 0.15
174 0.12
175 0.1
176 0.09
177 0.11
178 0.13
179 0.14
180 0.16
181 0.15
182 0.15
183 0.2
184 0.19
185 0.16
186 0.15
187 0.15
188 0.14
189 0.2
190 0.2
191 0.17
192 0.16
193 0.16
194 0.15
195 0.14
196 0.13
197 0.08
198 0.09
199 0.09
200 0.09
201 0.09
202 0.09
203 0.08
204 0.09
205 0.07
206 0.06
207 0.05
208 0.05
209 0.07
210 0.08
211 0.11
212 0.11
213 0.12
214 0.15
215 0.19
216 0.26
217 0.25
218 0.26
219 0.25
220 0.26
221 0.26
222 0.24
223 0.21
224 0.15
225 0.16
226 0.16
227 0.15
228 0.15
229 0.16
230 0.16
231 0.14
232 0.22
233 0.22
234 0.23
235 0.25
236 0.26
237 0.27
238 0.3
239 0.3
240 0.24
241 0.23
242 0.21
243 0.24
244 0.22
245 0.2
246 0.18
247 0.17
248 0.16
249 0.13
250 0.13
251 0.12
252 0.16
253 0.24
254 0.27
255 0.29