Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1DJZ6

Protein Details
Accession A1DJZ6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-52APAPRGRRGRPPGRGRVAARBasic
NLS Segment(s)
PositionSequence
7-64RGSAARRARAARRAAAPAATAAATAPAPAPRGRRGRPPGRGRVAARAGRGRGVSRGRG
Subcellular Location(s) mito 23, nucl 2, extr 2
Family & Domain DBs
KEGG nfi:NFIA_003910  -  
Amino Acid Sequences MANVRSRGSAARRARAARRAAAPAATAAATAPAPAPRGRRGRPPGRGRVAARAGRGRGVSRGRGGALVGVVISAPASAAPPPPPPPPPAASSLAPPLGPGRAPVGEHCYRCLQAPRWGGGAPLPFCNGYSQDGAKCLRCRALHQPCQSFPAAALPEADDVVAAQVALEVAHPRAVGLALEAVARAAQAFRARVAASGGPLPRGAPPALAPVAAAASPTPPFVSAPGSPMAAPAPAGIWAAAVQFFSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.65
3 0.66
4 0.62
5 0.6
6 0.58
7 0.53
8 0.47
9 0.41
10 0.33
11 0.29
12 0.22
13 0.16
14 0.11
15 0.1
16 0.08
17 0.08
18 0.08
19 0.08
20 0.11
21 0.14
22 0.18
23 0.25
24 0.34
25 0.37
26 0.47
27 0.55
28 0.63
29 0.7
30 0.75
31 0.78
32 0.77
33 0.8
34 0.73
35 0.72
36 0.7
37 0.63
38 0.59
39 0.54
40 0.48
41 0.43
42 0.42
43 0.35
44 0.33
45 0.34
46 0.33
47 0.29
48 0.3
49 0.27
50 0.26
51 0.24
52 0.18
53 0.14
54 0.1
55 0.07
56 0.05
57 0.04
58 0.04
59 0.04
60 0.02
61 0.02
62 0.02
63 0.03
64 0.04
65 0.06
66 0.08
67 0.1
68 0.14
69 0.17
70 0.2
71 0.21
72 0.25
73 0.26
74 0.27
75 0.28
76 0.29
77 0.26
78 0.26
79 0.26
80 0.23
81 0.2
82 0.18
83 0.14
84 0.11
85 0.1
86 0.09
87 0.09
88 0.09
89 0.09
90 0.1
91 0.16
92 0.2
93 0.2
94 0.22
95 0.22
96 0.21
97 0.23
98 0.27
99 0.23
100 0.26
101 0.28
102 0.28
103 0.27
104 0.27
105 0.25
106 0.22
107 0.23
108 0.16
109 0.14
110 0.13
111 0.12
112 0.12
113 0.13
114 0.12
115 0.1
116 0.11
117 0.12
118 0.11
119 0.14
120 0.15
121 0.18
122 0.18
123 0.17
124 0.21
125 0.2
126 0.24
127 0.32
128 0.41
129 0.46
130 0.51
131 0.55
132 0.5
133 0.53
134 0.5
135 0.39
136 0.29
137 0.26
138 0.2
139 0.15
140 0.15
141 0.12
142 0.12
143 0.11
144 0.11
145 0.05
146 0.04
147 0.04
148 0.04
149 0.03
150 0.02
151 0.02
152 0.03
153 0.03
154 0.03
155 0.04
156 0.04
157 0.06
158 0.06
159 0.05
160 0.06
161 0.06
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.06
174 0.09
175 0.1
176 0.1
177 0.13
178 0.13
179 0.13
180 0.16
181 0.14
182 0.13
183 0.17
184 0.17
185 0.16
186 0.16
187 0.16
188 0.15
189 0.17
190 0.16
191 0.12
192 0.13
193 0.17
194 0.17
195 0.17
196 0.15
197 0.12
198 0.13
199 0.12
200 0.11
201 0.06
202 0.07
203 0.08
204 0.09
205 0.09
206 0.09
207 0.1
208 0.11
209 0.15
210 0.14
211 0.16
212 0.17
213 0.18
214 0.17
215 0.17
216 0.17
217 0.13
218 0.12
219 0.1
220 0.08
221 0.08
222 0.09
223 0.08
224 0.07
225 0.07
226 0.08
227 0.08