Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LS02

Protein Details
Accession E2LS02   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-116HNDKKVKRVHVQKRENPIVNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
KEGG mpr:MPER_09786  -  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MGKDKVENEELIKYAWPQDIWFHVDKPSSAHVYLRLPEGGGSMTWETIPEVLLTDCAQLVKANSIEGNKKDNLTVIYTPADNLKKTGDTAVGQVSFHNDKKVKRVHVQKRENPIVNRLNKTKVERQVDHEQERVDRIKETALRRARYPDMLMIRPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.18
4 0.16
5 0.19
6 0.21
7 0.25
8 0.26
9 0.24
10 0.25
11 0.26
12 0.25
13 0.26
14 0.26
15 0.25
16 0.23
17 0.24
18 0.24
19 0.26
20 0.27
21 0.26
22 0.22
23 0.18
24 0.17
25 0.17
26 0.14
27 0.1
28 0.11
29 0.09
30 0.09
31 0.08
32 0.08
33 0.08
34 0.07
35 0.08
36 0.05
37 0.06
38 0.05
39 0.06
40 0.06
41 0.06
42 0.07
43 0.06
44 0.06
45 0.06
46 0.07
47 0.08
48 0.08
49 0.08
50 0.09
51 0.11
52 0.15
53 0.16
54 0.2
55 0.18
56 0.18
57 0.18
58 0.18
59 0.17
60 0.16
61 0.15
62 0.13
63 0.13
64 0.12
65 0.12
66 0.15
67 0.15
68 0.12
69 0.13
70 0.12
71 0.12
72 0.12
73 0.13
74 0.11
75 0.1
76 0.11
77 0.13
78 0.12
79 0.11
80 0.11
81 0.14
82 0.16
83 0.16
84 0.21
85 0.22
86 0.23
87 0.3
88 0.37
89 0.39
90 0.44
91 0.54
92 0.59
93 0.67
94 0.76
95 0.75
96 0.79
97 0.81
98 0.8
99 0.71
100 0.69
101 0.67
102 0.64
103 0.62
104 0.56
105 0.54
106 0.52
107 0.57
108 0.57
109 0.57
110 0.59
111 0.56
112 0.59
113 0.64
114 0.67
115 0.64
116 0.59
117 0.52
118 0.45
119 0.48
120 0.44
121 0.35
122 0.28
123 0.24
124 0.28
125 0.33
126 0.35
127 0.4
128 0.44
129 0.46
130 0.48
131 0.54
132 0.52
133 0.5
134 0.49
135 0.47
136 0.46