Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0MK20

Protein Details
Accession A0A2X0MK20    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
89-111FFPSRHASPKRDKRESRRPALVRBasic
NLS Segment(s)
PositionSequence
97-106PKRDKRESRR
Subcellular Location(s) nucl 13, cyto 6.5, cyto_mito 5.5, mito 3.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008928  6-hairpin_glycosidase_sf  
IPR012341  6hp_glycosidase-like_sf  
IPR008313  GH125  
Gene Ontology GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF06824  Glyco_hydro_125  
Amino Acid Sequences MSIMMRALTSDDDHEILECLDMSKQCTAGTGLMHESYQKDDPRRYTRSWFAWANGLFGELILDVWESLVGGGSELSEIGRNWWKPVVLFFPSRHASPKRDKRESRRPALVRSPLVPLRITQNVSLFGSPTHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.11
5 0.09
6 0.08
7 0.09
8 0.1
9 0.12
10 0.13
11 0.13
12 0.13
13 0.14
14 0.14
15 0.13
16 0.13
17 0.13
18 0.13
19 0.13
20 0.13
21 0.13
22 0.13
23 0.15
24 0.19
25 0.22
26 0.25
27 0.29
28 0.37
29 0.43
30 0.48
31 0.47
32 0.49
33 0.51
34 0.51
35 0.52
36 0.46
37 0.39
38 0.4
39 0.37
40 0.32
41 0.24
42 0.21
43 0.14
44 0.12
45 0.11
46 0.05
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.02
54 0.02
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.07
66 0.12
67 0.12
68 0.14
69 0.15
70 0.15
71 0.15
72 0.17
73 0.19
74 0.18
75 0.21
76 0.21
77 0.26
78 0.28
79 0.29
80 0.33
81 0.32
82 0.36
83 0.43
84 0.53
85 0.56
86 0.65
87 0.73
88 0.77
89 0.84
90 0.87
91 0.85
92 0.85
93 0.79
94 0.76
95 0.76
96 0.74
97 0.67
98 0.59
99 0.57
100 0.49
101 0.47
102 0.4
103 0.32
104 0.31
105 0.33
106 0.33
107 0.28
108 0.28
109 0.3
110 0.31
111 0.31
112 0.25