Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0P215

Protein Details
Accession A0A2X0P215    Localization Confidence High Confidence Score 23.2
NoLS Segment(s)
PositionSequenceProtein Nature
157-179EEEKPKKKKTAAPAKKRAKKEATBasic
193-224TDEEEKPKKKKARSSKSKSKSKKGKSDSEASFBasic
230-251SPAPTPRKPSIRRTAHKASMKEHydrophilic
NLS Segment(s)
PositionSequence
124-149PAKEGHSSPNKRAPAPKAKSKSKKAQ
158-176EEKPKKKKTAAPAKKRAKK
198-217KPKKKKARSSKSKSKSKKGK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR005819  H1/H5  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0030527  F:structural constituent of chromatin  
GO:0008270  F:zinc ion binding  
GO:0006334  P:nucleosome assembly  
Pfam View protein in Pfam  
PF00645  zf-PARP  
PROSITE View protein in PROSITE  
PS50064  ZF_PARP_2  
Amino Acid Sequences MQRSYPLCAGPKPCSGTKIGKAGPAPTASRHCGELRFGTVVDIMGRTSFQWRHWGCLTKTVLANVKNKIDKAEDIDGFEDLREEDQERVKKAYETGHIAPEDIPESAKAKGEEGDESPADEGRPAKEGHSSPNKRAPAPKAKSKSKKAQAEDEEELEEEKPKKKKTAAPAKKRAKKEATPDEDSEEEAEAVSTDEEEKPKKKKARSSKSKSKSKKGKSDSEASFHLSADSPAPTPRKPSIRRTAHKASMKEEDDDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.47
4 0.47
5 0.51
6 0.46
7 0.46
8 0.46
9 0.45
10 0.44
11 0.4
12 0.35
13 0.32
14 0.35
15 0.34
16 0.34
17 0.35
18 0.33
19 0.31
20 0.33
21 0.31
22 0.29
23 0.27
24 0.25
25 0.22
26 0.21
27 0.19
28 0.16
29 0.13
30 0.09
31 0.08
32 0.08
33 0.08
34 0.14
35 0.15
36 0.16
37 0.26
38 0.26
39 0.31
40 0.36
41 0.44
42 0.39
43 0.45
44 0.47
45 0.41
46 0.41
47 0.4
48 0.4
49 0.37
50 0.41
51 0.37
52 0.41
53 0.39
54 0.39
55 0.37
56 0.34
57 0.31
58 0.31
59 0.33
60 0.27
61 0.26
62 0.26
63 0.24
64 0.21
65 0.19
66 0.14
67 0.08
68 0.08
69 0.07
70 0.08
71 0.1
72 0.16
73 0.2
74 0.21
75 0.23
76 0.23
77 0.23
78 0.24
79 0.26
80 0.24
81 0.26
82 0.26
83 0.28
84 0.27
85 0.27
86 0.25
87 0.21
88 0.18
89 0.12
90 0.11
91 0.08
92 0.09
93 0.09
94 0.11
95 0.1
96 0.1
97 0.12
98 0.12
99 0.13
100 0.12
101 0.14
102 0.12
103 0.13
104 0.12
105 0.11
106 0.1
107 0.09
108 0.09
109 0.07
110 0.09
111 0.09
112 0.09
113 0.13
114 0.14
115 0.2
116 0.3
117 0.32
118 0.34
119 0.41
120 0.42
121 0.39
122 0.44
123 0.45
124 0.45
125 0.47
126 0.53
127 0.53
128 0.61
129 0.69
130 0.72
131 0.75
132 0.73
133 0.76
134 0.71
135 0.72
136 0.66
137 0.64
138 0.58
139 0.49
140 0.4
141 0.32
142 0.29
143 0.2
144 0.19
145 0.14
146 0.19
147 0.23
148 0.25
149 0.3
150 0.35
151 0.41
152 0.48
153 0.58
154 0.62
155 0.68
156 0.76
157 0.82
158 0.85
159 0.84
160 0.82
161 0.79
162 0.74
163 0.74
164 0.73
165 0.7
166 0.67
167 0.63
168 0.58
169 0.5
170 0.44
171 0.35
172 0.25
173 0.17
174 0.12
175 0.1
176 0.06
177 0.06
178 0.06
179 0.05
180 0.06
181 0.08
182 0.11
183 0.16
184 0.22
185 0.27
186 0.37
187 0.45
188 0.51
189 0.59
190 0.67
191 0.74
192 0.8
193 0.85
194 0.87
195 0.89
196 0.93
197 0.92
198 0.92
199 0.91
200 0.9
201 0.9
202 0.87
203 0.87
204 0.83
205 0.83
206 0.76
207 0.7
208 0.62
209 0.56
210 0.49
211 0.38
212 0.33
213 0.24
214 0.21
215 0.18
216 0.17
217 0.13
218 0.18
219 0.22
220 0.22
221 0.28
222 0.35
223 0.43
224 0.48
225 0.57
226 0.62
227 0.69
228 0.76
229 0.79
230 0.81
231 0.8
232 0.82
233 0.75
234 0.71
235 0.69
236 0.64
237 0.58
238 0.49