Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0NVT8

Protein Details
Accession A0A2X0NVT8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-29AKAGAAGKKKKWSKGKVKDKANNAVVCHydrophilic
NLS Segment(s)
PositionSequence
4-21KAGAAGKKKKWSKGKVKD
Subcellular Location(s) nucl 14, cyto 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MRAKAGAAGKKKKWSKGKVKDKANNAVVCDKATFDRIMKEVPTYKLISQSVLIDRMKINGSLARVAIRQLKKEGLIKPVVHHTSQLVYTRAIAAEAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.8
4 0.86
5 0.85
6 0.9
7 0.88
8 0.85
9 0.84
10 0.8
11 0.71
12 0.63
13 0.57
14 0.47
15 0.4
16 0.33
17 0.24
18 0.18
19 0.17
20 0.16
21 0.12
22 0.14
23 0.14
24 0.15
25 0.15
26 0.16
27 0.18
28 0.19
29 0.21
30 0.21
31 0.2
32 0.23
33 0.23
34 0.2
35 0.17
36 0.17
37 0.15
38 0.18
39 0.17
40 0.13
41 0.13
42 0.14
43 0.14
44 0.13
45 0.12
46 0.1
47 0.12
48 0.12
49 0.12
50 0.12
51 0.11
52 0.13
53 0.21
54 0.21
55 0.23
56 0.24
57 0.26
58 0.28
59 0.34
60 0.35
61 0.33
62 0.37
63 0.35
64 0.35
65 0.42
66 0.42
67 0.36
68 0.34
69 0.3
70 0.27
71 0.3
72 0.31
73 0.24
74 0.21
75 0.22
76 0.22
77 0.2