Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0N537

Protein Details
Accession A0A2X0N537    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-33TLSSRQTRRGCHKNSRTKSRHHAAIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MARHWHGGTLSSRQTRRGCHKNSRTKSRHHAAIPGCDGVRCQTWKASAAHHDDVRLQLTGNQGCTGADTACNRPDLIARVFEAKSGNKRHEYKMNGFCLFATVRLSCYWFNFILPLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.6
4 0.63
5 0.63
6 0.66
7 0.75
8 0.79
9 0.85
10 0.88
11 0.84
12 0.82
13 0.84
14 0.8
15 0.77
16 0.68
17 0.66
18 0.58
19 0.59
20 0.53
21 0.45
22 0.37
23 0.29
24 0.28
25 0.22
26 0.22
27 0.17
28 0.15
29 0.15
30 0.17
31 0.21
32 0.22
33 0.23
34 0.24
35 0.29
36 0.31
37 0.29
38 0.28
39 0.25
40 0.25
41 0.23
42 0.18
43 0.11
44 0.1
45 0.13
46 0.13
47 0.13
48 0.12
49 0.11
50 0.11
51 0.11
52 0.1
53 0.07
54 0.08
55 0.1
56 0.12
57 0.14
58 0.14
59 0.14
60 0.13
61 0.15
62 0.17
63 0.16
64 0.15
65 0.14
66 0.18
67 0.18
68 0.19
69 0.2
70 0.2
71 0.26
72 0.3
73 0.35
74 0.39
75 0.43
76 0.47
77 0.53
78 0.56
79 0.58
80 0.6
81 0.62
82 0.55
83 0.51
84 0.46
85 0.4
86 0.34
87 0.26
88 0.21
89 0.15
90 0.15
91 0.16
92 0.19
93 0.18
94 0.2
95 0.23
96 0.2
97 0.2