Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0M534

Protein Details
Accession A0A2X0M534   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-49VGKEKEKDTKTKCKKFTRRRKKKAADTIIESBasic
52-83TTGPEEGAKKKKKKNKIRSWPVRERKKEPVLSBasic
NLS Segment(s)
PositionSequence
22-42EKEKDTKTKCKKFTRRRKKKA
58-80GAKKKKKKNKIRSWPVRERKKEP
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MGSLRHTPPPPQANPASLVGKEKEKDTKTKCKKFTRRRKKKAADTIIESGATTGPEEGAKKKKKKNKIRSWPVRERKKEPVLSPKSEAFVKSSGYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.39
4 0.31
5 0.32
6 0.27
7 0.3
8 0.28
9 0.28
10 0.32
11 0.32
12 0.41
13 0.45
14 0.54
15 0.59
16 0.68
17 0.74
18 0.77
19 0.85
20 0.87
21 0.91
22 0.91
23 0.92
24 0.93
25 0.95
26 0.94
27 0.93
28 0.92
29 0.9
30 0.83
31 0.76
32 0.69
33 0.58
34 0.48
35 0.37
36 0.27
37 0.18
38 0.13
39 0.08
40 0.05
41 0.04
42 0.05
43 0.07
44 0.11
45 0.2
46 0.29
47 0.37
48 0.46
49 0.54
50 0.64
51 0.74
52 0.81
53 0.84
54 0.86
55 0.9
56 0.93
57 0.94
58 0.94
59 0.94
60 0.93
61 0.9
62 0.85
63 0.84
64 0.82
65 0.79
66 0.75
67 0.76
68 0.73
69 0.71
70 0.69
71 0.61
72 0.55
73 0.5
74 0.44
75 0.36
76 0.31