Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0MQ99

Protein Details
Accession A0A2X0MQ99    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
67-86VPKGWAKQEKKKTNAGPKETHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, mito_nucl 10.666, nucl 8.5, cyto_nucl 7.833, cyto 5
Family & Domain DBs
Amino Acid Sequences MAVTATKANSYQASATTTADTSRTPNKLTHAMKDYLRRNNGCVSCCQINVDHFLRICMAEWHLAPDVPKGWAKQEKKKTNAGPKETQPDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.17
5 0.15
6 0.15
7 0.14
8 0.15
9 0.2
10 0.22
11 0.22
12 0.24
13 0.27
14 0.36
15 0.37
16 0.39
17 0.38
18 0.38
19 0.4
20 0.47
21 0.49
22 0.47
23 0.51
24 0.46
25 0.43
26 0.47
27 0.46
28 0.39
29 0.34
30 0.31
31 0.26
32 0.25
33 0.24
34 0.18
35 0.16
36 0.2
37 0.2
38 0.17
39 0.15
40 0.16
41 0.15
42 0.14
43 0.14
44 0.1
45 0.1
46 0.1
47 0.1
48 0.12
49 0.12
50 0.13
51 0.13
52 0.13
53 0.13
54 0.14
55 0.17
56 0.15
57 0.22
58 0.3
59 0.37
60 0.46
61 0.56
62 0.63
63 0.66
64 0.75
65 0.77
66 0.79
67 0.81
68 0.79
69 0.76
70 0.74