Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0N661

Protein Details
Accession A0A2X0N661   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
102-123STQSTSVHKTHKNKKHGPNQGHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, mito_nucl 10, nucl 7.5, cyto 4, extr 4
Family & Domain DBs
Amino Acid Sequences MVGYNFLILAALAMKSAASTVPRMSHCQKDCGMAVFESTDCTGWDKIRCICEDTMFTDRLVDCLSATPGCAKDIPSIKRQLCSKCRKAKIDGNDRPYVCKNSTQSTSVHKTHKNKKHGPNQGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.06
5 0.06
6 0.08
7 0.11
8 0.16
9 0.18
10 0.25
11 0.29
12 0.37
13 0.38
14 0.41
15 0.4
16 0.39
17 0.38
18 0.34
19 0.32
20 0.22
21 0.21
22 0.17
23 0.15
24 0.13
25 0.12
26 0.09
27 0.08
28 0.1
29 0.11
30 0.13
31 0.15
32 0.17
33 0.2
34 0.23
35 0.23
36 0.24
37 0.23
38 0.23
39 0.22
40 0.22
41 0.22
42 0.2
43 0.19
44 0.17
45 0.16
46 0.15
47 0.14
48 0.1
49 0.07
50 0.07
51 0.08
52 0.06
53 0.07
54 0.08
55 0.07
56 0.08
57 0.09
58 0.09
59 0.13
60 0.2
61 0.23
62 0.27
63 0.34
64 0.35
65 0.39
66 0.43
67 0.47
68 0.5
69 0.57
70 0.62
71 0.64
72 0.71
73 0.72
74 0.74
75 0.73
76 0.73
77 0.75
78 0.73
79 0.7
80 0.69
81 0.64
82 0.62
83 0.59
84 0.53
85 0.44
86 0.43
87 0.4
88 0.39
89 0.42
90 0.39
91 0.38
92 0.41
93 0.46
94 0.46
95 0.5
96 0.52
97 0.58
98 0.67
99 0.74
100 0.76
101 0.79
102 0.83
103 0.86