Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0NQA1

Protein Details
Accession A0A2X0NQA1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
109-128VYRCRVGVVGQTRRRRWRRSHydrophilic
NLS Segment(s)
PositionSequence
122-127RRRWRR
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013965  DASH_Dad3  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005874  C:microtubule  
GO:0072686  C:mitotic spindle  
GO:0008608  P:attachment of spindle microtubules to kinetochore  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF08656  DASH_Dad3  
Amino Acid Sequences MASASIANAAAVHTLVARLEDQVLKEYSNVSHNLDEMSTVLQRLSSMQPYILNQFRPLERKLGLVLTLFKGTYPPLGSSVTSKRVEQRGTARQNPHLVLTDGMSHVACVYRCRVGVVGQTRRRRWRRSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.07
5 0.07
6 0.1
7 0.11
8 0.12
9 0.15
10 0.16
11 0.15
12 0.15
13 0.16
14 0.15
15 0.17
16 0.18
17 0.17
18 0.17
19 0.17
20 0.17
21 0.15
22 0.14
23 0.11
24 0.11
25 0.08
26 0.08
27 0.07
28 0.07
29 0.07
30 0.09
31 0.11
32 0.11
33 0.11
34 0.12
35 0.13
36 0.14
37 0.19
38 0.19
39 0.18
40 0.17
41 0.19
42 0.21
43 0.23
44 0.23
45 0.21
46 0.19
47 0.19
48 0.19
49 0.17
50 0.15
51 0.12
52 0.12
53 0.1
54 0.1
55 0.09
56 0.08
57 0.08
58 0.08
59 0.09
60 0.09
61 0.08
62 0.1
63 0.11
64 0.11
65 0.15
66 0.18
67 0.23
68 0.23
69 0.24
70 0.27
71 0.31
72 0.32
73 0.33
74 0.37
75 0.41
76 0.47
77 0.53
78 0.52
79 0.52
80 0.55
81 0.51
82 0.45
83 0.38
84 0.31
85 0.25
86 0.22
87 0.19
88 0.15
89 0.15
90 0.12
91 0.1
92 0.09
93 0.11
94 0.11
95 0.11
96 0.14
97 0.16
98 0.16
99 0.18
100 0.19
101 0.19
102 0.27
103 0.34
104 0.42
105 0.48
106 0.57
107 0.64
108 0.74
109 0.8