Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0MQM1

Protein Details
Accession A0A2X0MQM1   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-94QPKRRAPQATFDRPRRARKRSERVFEDFHydrophilic
NLS Segment(s)
PositionSequence
70-72RRA
77-86FDRPRRARKR
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MPSKGLPPFGACPACEMPPAEPLQVAQMPPRKQGAQLRQKGSLTTKQRASQQSKEGLFEAWSHAQHQPKRRAPQATFDRPRRARKRSERVFEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.26
4 0.2
5 0.23
6 0.24
7 0.19
8 0.17
9 0.16
10 0.18
11 0.19
12 0.18
13 0.19
14 0.24
15 0.26
16 0.28
17 0.31
18 0.28
19 0.3
20 0.38
21 0.43
22 0.46
23 0.52
24 0.53
25 0.53
26 0.53
27 0.5
28 0.46
29 0.44
30 0.39
31 0.37
32 0.37
33 0.36
34 0.42
35 0.48
36 0.51
37 0.48
38 0.47
39 0.49
40 0.46
41 0.44
42 0.38
43 0.31
44 0.25
45 0.21
46 0.19
47 0.15
48 0.15
49 0.16
50 0.19
51 0.26
52 0.3
53 0.39
54 0.45
55 0.51
56 0.58
57 0.63
58 0.68
59 0.62
60 0.68
61 0.69
62 0.7
63 0.71
64 0.71
65 0.75
66 0.74
67 0.83
68 0.82
69 0.8
70 0.8
71 0.82
72 0.86
73 0.85
74 0.88