Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0NA51

Protein Details
Accession A0A2X0NA51    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MMNVFYKKKKGRTTSKWMWVRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MMNVFYKKKKGRTTSKWMWVRLACAIGFQRLHLLRWHVHQRFEKDRVVAPPSIPSALRAFNRDYLSRAGFVPGARDWEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.83
4 0.75
5 0.72
6 0.62
7 0.55
8 0.47
9 0.39
10 0.29
11 0.24
12 0.23
13 0.2
14 0.18
15 0.16
16 0.19
17 0.18
18 0.19
19 0.18
20 0.2
21 0.18
22 0.24
23 0.33
24 0.29
25 0.35
26 0.38
27 0.42
28 0.46
29 0.48
30 0.45
31 0.37
32 0.38
33 0.36
34 0.35
35 0.3
36 0.24
37 0.23
38 0.22
39 0.21
40 0.18
41 0.17
42 0.16
43 0.19
44 0.21
45 0.21
46 0.22
47 0.26
48 0.3
49 0.29
50 0.3
51 0.3
52 0.3
53 0.29
54 0.26
55 0.23
56 0.21
57 0.2
58 0.22
59 0.18