Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0MBC0

Protein Details
Accession A0A2X0MBC0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-57ATQNWWDKHNKPKQWKDIRAQYDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, golg 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MAITSSLTRVFSRNSVFVGTVFFGAFAFSMGFDVATQNWWDKHNKPKQWKDIRAQYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.22
4 0.2
5 0.19
6 0.15
7 0.12
8 0.1
9 0.09
10 0.07
11 0.07
12 0.06
13 0.05
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.05
23 0.06
24 0.08
25 0.1
26 0.12
27 0.17
28 0.22
29 0.32
30 0.41
31 0.5
32 0.59
33 0.68
34 0.77
35 0.83
36 0.87
37 0.86