Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0PPY1

Protein Details
Accession A0A2X0PPY1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
68-87YMNRMKQLEKAERKRREEEEBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008698  NDUB7  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005758  C:mitochondrial intermembrane space  
GO:0070469  C:respirasome  
Pfam View protein in Pfam  
PF05676  NDUF_B7  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MGAHATGPFEPQPAAPELANRARLPIGWRDQCGKLLVPLNVCRHENLYMTWKCDHEKHVYEKCQYDDYMNRMKQLEKAERKRREEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.17
4 0.21
5 0.25
6 0.29
7 0.26
8 0.25
9 0.23
10 0.25
11 0.25
12 0.27
13 0.3
14 0.29
15 0.31
16 0.34
17 0.35
18 0.35
19 0.34
20 0.27
21 0.22
22 0.23
23 0.22
24 0.21
25 0.25
26 0.26
27 0.27
28 0.27
29 0.24
30 0.22
31 0.22
32 0.2
33 0.17
34 0.22
35 0.2
36 0.23
37 0.24
38 0.23
39 0.24
40 0.25
41 0.27
42 0.26
43 0.3
44 0.36
45 0.43
46 0.47
47 0.49
48 0.5
49 0.49
50 0.45
51 0.41
52 0.37
53 0.34
54 0.34
55 0.4
56 0.37
57 0.38
58 0.36
59 0.37
60 0.38
61 0.42
62 0.47
63 0.48
64 0.58
65 0.65
66 0.73
67 0.79