Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0LXA1

Protein Details
Accession A0A2X0LXA1   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
282-309QPKRRAPQATFDRPPRARKRSERVFEDFHydrophilic
NLS Segment(s)
PositionSequence
294-301RPPRARKR
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 2, cysk 2
Family & Domain DBs
Amino Acid Sequences MNMTIAELLAFDVAPADASLHIELSKDEHTQYSTLSSTRGPTSSCSTQGRPMEATDPTRGEAGARSMGPSRCEDMAGTTRSLNEIQKNAYIEDGRIQEKLPERDKQYGALAQRYPHFGSLDGAVTAATPLGIGSLICFGLKCGMHSLSCDQTAYGEEALSIGIVTTNHCNQDRLASLVLLSNVVVQELRLIKKTCYSTHLIDGTMPFRMIDARAHMPSKGLPPFGACPACEMPPAEPLQAAQMPPRKQGAQLQQKGSLTTKQRASQQSKEGLFEAWSHAQHQPKRRAPQATFDRPPRARKRSERVFEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.08
6 0.09
7 0.09
8 0.09
9 0.09
10 0.1
11 0.12
12 0.15
13 0.15
14 0.15
15 0.17
16 0.18
17 0.19
18 0.19
19 0.19
20 0.18
21 0.17
22 0.18
23 0.17
24 0.19
25 0.21
26 0.21
27 0.19
28 0.21
29 0.28
30 0.3
31 0.35
32 0.37
33 0.36
34 0.43
35 0.45
36 0.45
37 0.39
38 0.37
39 0.34
40 0.33
41 0.33
42 0.3
43 0.28
44 0.25
45 0.24
46 0.22
47 0.19
48 0.17
49 0.16
50 0.16
51 0.14
52 0.15
53 0.2
54 0.22
55 0.23
56 0.24
57 0.24
58 0.21
59 0.22
60 0.2
61 0.2
62 0.24
63 0.24
64 0.23
65 0.2
66 0.2
67 0.21
68 0.23
69 0.22
70 0.2
71 0.21
72 0.21
73 0.24
74 0.25
75 0.23
76 0.24
77 0.2
78 0.17
79 0.19
80 0.2
81 0.18
82 0.17
83 0.17
84 0.19
85 0.25
86 0.32
87 0.31
88 0.34
89 0.37
90 0.43
91 0.43
92 0.41
93 0.37
94 0.35
95 0.33
96 0.32
97 0.3
98 0.25
99 0.26
100 0.28
101 0.26
102 0.23
103 0.21
104 0.17
105 0.16
106 0.15
107 0.14
108 0.1
109 0.09
110 0.07
111 0.07
112 0.06
113 0.05
114 0.03
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.03
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.07
127 0.08
128 0.08
129 0.09
130 0.1
131 0.11
132 0.12
133 0.14
134 0.13
135 0.13
136 0.13
137 0.1
138 0.1
139 0.1
140 0.1
141 0.08
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.04
148 0.02
149 0.03
150 0.03
151 0.04
152 0.06
153 0.08
154 0.11
155 0.12
156 0.12
157 0.12
158 0.15
159 0.15
160 0.15
161 0.14
162 0.11
163 0.11
164 0.11
165 0.11
166 0.08
167 0.07
168 0.06
169 0.05
170 0.05
171 0.05
172 0.04
173 0.07
174 0.1
175 0.11
176 0.14
177 0.16
178 0.16
179 0.22
180 0.25
181 0.24
182 0.25
183 0.29
184 0.27
185 0.31
186 0.32
187 0.26
188 0.24
189 0.24
190 0.21
191 0.17
192 0.15
193 0.1
194 0.08
195 0.09
196 0.09
197 0.09
198 0.12
199 0.16
200 0.18
201 0.19
202 0.19
203 0.19
204 0.2
205 0.25
206 0.23
207 0.2
208 0.18
209 0.2
210 0.22
211 0.26
212 0.25
213 0.19
214 0.21
215 0.23
216 0.23
217 0.22
218 0.21
219 0.17
220 0.2
221 0.21
222 0.17
223 0.15
224 0.14
225 0.17
226 0.18
227 0.18
228 0.2
229 0.26
230 0.27
231 0.3
232 0.34
233 0.31
234 0.31
235 0.39
236 0.43
237 0.47
238 0.52
239 0.53
240 0.55
241 0.55
242 0.55
243 0.49
244 0.45
245 0.41
246 0.4
247 0.42
248 0.41
249 0.49
250 0.56
251 0.61
252 0.61
253 0.63
254 0.65
255 0.61
256 0.59
257 0.51
258 0.43
259 0.36
260 0.3
261 0.28
262 0.23
263 0.22
264 0.23
265 0.27
266 0.34
267 0.4
268 0.49
269 0.54
270 0.59
271 0.67
272 0.71
273 0.76
274 0.7
275 0.74
276 0.75
277 0.75
278 0.75
279 0.73
280 0.76
281 0.73
282 0.8
283 0.8
284 0.79
285 0.78
286 0.8
287 0.83
288 0.84
289 0.88