Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0NHP6

Protein Details
Accession A0A2X0NHP6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
113-137QHPPTGPCRRCHKKGHWALDCKPRGBasic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 3, cyto 3, pero 3, cyto_mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MPASVEAYDTWLREYMSIVQEIRDAKTSLNDVLATHVLAMVPSCLDSFRLTFTDEQRNQCDFPELTTLTDRIRVQLRSAGLSTSHSAMLATASPCPACRAPGHRLRDCTSRAQHPPTGPCRRCHKKGHWALDCKPRGDQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.19
4 0.22
5 0.2
6 0.19
7 0.22
8 0.23
9 0.23
10 0.21
11 0.19
12 0.16
13 0.19
14 0.21
15 0.18
16 0.18
17 0.17
18 0.14
19 0.16
20 0.16
21 0.13
22 0.11
23 0.1
24 0.08
25 0.08
26 0.07
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.06
33 0.07
34 0.07
35 0.09
36 0.1
37 0.11
38 0.14
39 0.18
40 0.27
41 0.3
42 0.33
43 0.36
44 0.37
45 0.36
46 0.34
47 0.33
48 0.23
49 0.2
50 0.21
51 0.17
52 0.16
53 0.16
54 0.17
55 0.13
56 0.17
57 0.16
58 0.14
59 0.17
60 0.16
61 0.16
62 0.18
63 0.19
64 0.16
65 0.17
66 0.15
67 0.12
68 0.13
69 0.13
70 0.11
71 0.1
72 0.09
73 0.08
74 0.08
75 0.08
76 0.08
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.12
83 0.11
84 0.12
85 0.15
86 0.2
87 0.27
88 0.36
89 0.44
90 0.46
91 0.5
92 0.52
93 0.55
94 0.53
95 0.54
96 0.51
97 0.51
98 0.53
99 0.54
100 0.55
101 0.53
102 0.59
103 0.6
104 0.66
105 0.61
106 0.62
107 0.67
108 0.72
109 0.74
110 0.76
111 0.76
112 0.76
113 0.82
114 0.85
115 0.84
116 0.83
117 0.83
118 0.84
119 0.8
120 0.71