Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0NXD8

Protein Details
Accession A0A2X0NXD8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPASKKDIRKNEQKKKEALGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039438  At2g23090-like_Znf  
IPR026939  ZNF706/At2g23090_sf  
Pfam View protein in Pfam  
PF12907  zf-met2  
Amino Acid Sequences MPASKKDIRKNEQKKKEALGIKLDTTAGGVLKKAPKAMLTCTVCKQQLVASMPIMLRDHAVNKHPKQTPNECFPGATIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.75
3 0.76
4 0.71
5 0.63
6 0.6
7 0.52
8 0.46
9 0.42
10 0.36
11 0.27
12 0.21
13 0.18
14 0.1
15 0.08
16 0.07
17 0.09
18 0.12
19 0.13
20 0.13
21 0.13
22 0.15
23 0.16
24 0.18
25 0.24
26 0.24
27 0.25
28 0.27
29 0.3
30 0.28
31 0.27
32 0.24
33 0.17
34 0.21
35 0.21
36 0.21
37 0.17
38 0.19
39 0.19
40 0.2
41 0.19
42 0.13
43 0.11
44 0.11
45 0.14
46 0.15
47 0.22
48 0.29
49 0.32
50 0.41
51 0.46
52 0.51
53 0.56
54 0.63
55 0.65
56 0.64
57 0.66
58 0.58
59 0.53
60 0.47