Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0PFH9

Protein Details
Accession A0A2X0PFH9   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
146-169AHNKRVRFTRTPKPKENNSRGRNGHydrophilic
NLS Segment(s)
PositionSequence
146-181AHNKRVRFTRTPKPKENNSRGRNGGARPKSRGAGRV
Subcellular Location(s) nucl 12.5, mito_nucl 12.333, mito 10, cyto_nucl 9.166
Family & Domain DBs
Amino Acid Sequences MSFHQPLRNGFRWAKIAKSPHPQAPSRFRPPTQNPEFNDRLSYVRDVDEGKKLVARRLIRSSWSHDSVDCRKLLLDKVKKEHHNSLYTPAFKSLEELETVGPLPRLCSGSYKALVWLRVGNNFENLRAQYRKELAAFLEANPGFKAHNKRVRFTRTPKPKENNSRGRNGGARPKSRGAGRVTRPQAPGAQFLPSLGSARLDPTHRPGSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.51
4 0.52
5 0.59
6 0.59
7 0.59
8 0.64
9 0.64
10 0.65
11 0.67
12 0.69
13 0.68
14 0.69
15 0.64
16 0.67
17 0.7
18 0.73
19 0.72
20 0.71
21 0.65
22 0.66
23 0.67
24 0.58
25 0.52
26 0.43
27 0.35
28 0.3
29 0.29
30 0.22
31 0.19
32 0.2
33 0.2
34 0.21
35 0.25
36 0.23
37 0.21
38 0.23
39 0.24
40 0.26
41 0.3
42 0.31
43 0.31
44 0.36
45 0.38
46 0.39
47 0.41
48 0.44
49 0.44
50 0.44
51 0.39
52 0.34
53 0.38
54 0.39
55 0.4
56 0.33
57 0.27
58 0.24
59 0.25
60 0.29
61 0.32
62 0.34
63 0.36
64 0.43
65 0.5
66 0.55
67 0.59
68 0.62
69 0.58
70 0.55
71 0.5
72 0.5
73 0.47
74 0.44
75 0.39
76 0.32
77 0.27
78 0.22
79 0.23
80 0.17
81 0.13
82 0.11
83 0.11
84 0.09
85 0.09
86 0.09
87 0.08
88 0.07
89 0.06
90 0.06
91 0.07
92 0.08
93 0.08
94 0.11
95 0.13
96 0.16
97 0.17
98 0.16
99 0.18
100 0.19
101 0.19
102 0.17
103 0.18
104 0.16
105 0.18
106 0.2
107 0.17
108 0.2
109 0.2
110 0.2
111 0.18
112 0.18
113 0.2
114 0.2
115 0.2
116 0.2
117 0.22
118 0.23
119 0.21
120 0.21
121 0.17
122 0.21
123 0.2
124 0.16
125 0.22
126 0.2
127 0.2
128 0.19
129 0.19
130 0.15
131 0.19
132 0.27
133 0.28
134 0.37
135 0.39
136 0.45
137 0.53
138 0.61
139 0.65
140 0.65
141 0.66
142 0.69
143 0.75
144 0.79
145 0.79
146 0.8
147 0.83
148 0.86
149 0.86
150 0.8
151 0.8
152 0.73
153 0.7
154 0.64
155 0.59
156 0.59
157 0.57
158 0.57
159 0.55
160 0.56
161 0.55
162 0.53
163 0.53
164 0.5
165 0.51
166 0.52
167 0.57
168 0.57
169 0.59
170 0.58
171 0.54
172 0.53
173 0.46
174 0.44
175 0.35
176 0.33
177 0.27
178 0.25
179 0.25
180 0.2
181 0.19
182 0.15
183 0.15
184 0.12
185 0.16
186 0.2
187 0.2
188 0.23
189 0.28