Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0PEQ8

Protein Details
Accession A0A2X0PEQ8   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-37SGGETVRRAKKQRFNPVPRPLSNHydrophilic
155-177YEPDSDAKSHRKQKQPKAPSVEAHydrophilic
NLS Segment(s)
PositionSequence
97-111KKRKMTGGTGKKGKK
133-210KKKSKVQKVVSPRRSAERARTKYEPDSDAKSHRKQKQPKAPSVEAQKAQERANKKQAQLEAAKAIVAARTKAKKDRAK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MPSTTALPQKKYRSSGGETVRRAKKQRFNPVPRPLSNATHHNGVGGSKGKGRVTPVAAKPSPVNARTTQSDEEEENALTGEEDDEVDVSEAPVAPLKKRKMTGGTGKKGKKFVESQSDLLSLVHSITGAHEIKKKSKVQKVVSPRRSAERARTKYEPDSDAKSHRKQKQPKAPSVEAQKAQERANKKQAQLEAAKAIVAARTKAKKDRAKAAEDMANSEPQDGRKRVSFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.64
4 0.64
5 0.62
6 0.67
7 0.7
8 0.7
9 0.71
10 0.72
11 0.71
12 0.72
13 0.79
14 0.8
15 0.82
16 0.85
17 0.88
18 0.87
19 0.8
20 0.77
21 0.7
22 0.65
23 0.59
24 0.55
25 0.48
26 0.43
27 0.41
28 0.34
29 0.3
30 0.24
31 0.24
32 0.21
33 0.19
34 0.18
35 0.22
36 0.22
37 0.23
38 0.26
39 0.27
40 0.29
41 0.36
42 0.37
43 0.42
44 0.42
45 0.42
46 0.39
47 0.41
48 0.42
49 0.35
50 0.35
51 0.28
52 0.32
53 0.34
54 0.38
55 0.33
56 0.29
57 0.29
58 0.26
59 0.25
60 0.22
61 0.19
62 0.14
63 0.12
64 0.1
65 0.07
66 0.07
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.07
80 0.07
81 0.09
82 0.17
83 0.2
84 0.24
85 0.25
86 0.28
87 0.3
88 0.36
89 0.44
90 0.47
91 0.52
92 0.56
93 0.6
94 0.6
95 0.59
96 0.54
97 0.47
98 0.42
99 0.39
100 0.4
101 0.39
102 0.37
103 0.34
104 0.34
105 0.3
106 0.26
107 0.2
108 0.11
109 0.07
110 0.06
111 0.04
112 0.04
113 0.04
114 0.08
115 0.09
116 0.11
117 0.15
118 0.18
119 0.22
120 0.29
121 0.35
122 0.39
123 0.45
124 0.53
125 0.54
126 0.6
127 0.67
128 0.71
129 0.72
130 0.69
131 0.64
132 0.61
133 0.6
134 0.55
135 0.54
136 0.54
137 0.52
138 0.53
139 0.55
140 0.53
141 0.54
142 0.55
143 0.49
144 0.41
145 0.42
146 0.39
147 0.44
148 0.47
149 0.5
150 0.55
151 0.6
152 0.66
153 0.7
154 0.78
155 0.8
156 0.82
157 0.83
158 0.83
159 0.78
160 0.75
161 0.74
162 0.7
163 0.63
164 0.58
165 0.54
166 0.48
167 0.47
168 0.46
169 0.44
170 0.44
171 0.51
172 0.52
173 0.49
174 0.53
175 0.52
176 0.54
177 0.51
178 0.47
179 0.39
180 0.34
181 0.31
182 0.25
183 0.22
184 0.18
185 0.16
186 0.14
187 0.19
188 0.26
189 0.31
190 0.39
191 0.48
192 0.54
193 0.59
194 0.68
195 0.67
196 0.66
197 0.65
198 0.63
199 0.59
200 0.51
201 0.49
202 0.41
203 0.38
204 0.32
205 0.3
206 0.27
207 0.26
208 0.35
209 0.32
210 0.34