Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0P696

Protein Details
Accession A0A2X0P696   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
10-29GRMASRSKSRRHKTIKLLGWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MSVCYASELGRMASRSKSRRHKTIKLLGWLRQDSKRAVMPSPQTADCEMSISSPGRPRPQFIYPQGSYNHRCECDALLREFSCWPSARQVGNGEAVQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.44
4 0.54
5 0.59
6 0.68
7 0.75
8 0.77
9 0.78
10 0.83
11 0.8
12 0.79
13 0.76
14 0.71
15 0.69
16 0.63
17 0.57
18 0.51
19 0.47
20 0.38
21 0.37
22 0.35
23 0.29
24 0.27
25 0.28
26 0.28
27 0.29
28 0.31
29 0.28
30 0.25
31 0.24
32 0.24
33 0.19
34 0.17
35 0.12
36 0.09
37 0.1
38 0.1
39 0.1
40 0.13
41 0.16
42 0.22
43 0.22
44 0.25
45 0.28
46 0.32
47 0.37
48 0.38
49 0.44
50 0.38
51 0.41
52 0.42
53 0.43
54 0.42
55 0.41
56 0.41
57 0.34
58 0.33
59 0.31
60 0.31
61 0.33
62 0.34
63 0.31
64 0.3
65 0.3
66 0.3
67 0.3
68 0.29
69 0.26
70 0.23
71 0.22
72 0.24
73 0.29
74 0.3
75 0.32
76 0.34
77 0.32
78 0.36