Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0NCH1

Protein Details
Accession A0A2X0NCH1    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
298-326ASGVRGPGPPRNKKKKTEHNPNRSQQTNPHydrophilic
NLS Segment(s)
PositionSequence
302-314RGPGPPRNKKKKT
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MAGSASEKDKENQRRNGKGTGSGSGSGPGLGSAGSGSSAQASGGLKLGPSLVRAKKYIDADGMYARKDKGNMGLRDYTCKRGQIEDFSVVRDALVVAGIRTPTLVQLYGPLAEINQEWSPNHDLPENYDLKDAFRLISAKTSTNTVLWGNLSPLKQREIVKYIRERAGFLAVTSGDWLYEELVIDVLANIRSAWKLAYDREVCRLAGIKGQLSKADIATLRSRHGEGPSRKSQDGVYSASDTGTSDLEEEEVLATRNRTLVPKKRGARQGARSPQLSQETQQTSPHVGSSGQRSTPAASGVRGPGPPRNKKKKTEHNPNRSQQTNPKRDLGNGRAEEEEDEDQGQDEEEVEELERSPRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.78
4 0.71
5 0.69
6 0.62
7 0.57
8 0.51
9 0.43
10 0.39
11 0.32
12 0.29
13 0.21
14 0.17
15 0.12
16 0.08
17 0.07
18 0.06
19 0.04
20 0.04
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.09
28 0.1
29 0.09
30 0.11
31 0.11
32 0.1
33 0.1
34 0.12
35 0.1
36 0.11
37 0.19
38 0.23
39 0.27
40 0.28
41 0.31
42 0.36
43 0.38
44 0.39
45 0.34
46 0.3
47 0.29
48 0.34
49 0.33
50 0.28
51 0.28
52 0.25
53 0.24
54 0.24
55 0.24
56 0.26
57 0.34
58 0.34
59 0.37
60 0.44
61 0.43
62 0.51
63 0.52
64 0.49
65 0.42
66 0.43
67 0.39
68 0.37
69 0.4
70 0.38
71 0.4
72 0.41
73 0.38
74 0.36
75 0.35
76 0.29
77 0.26
78 0.19
79 0.14
80 0.07
81 0.07
82 0.06
83 0.05
84 0.07
85 0.07
86 0.06
87 0.07
88 0.07
89 0.07
90 0.08
91 0.08
92 0.06
93 0.09
94 0.1
95 0.1
96 0.1
97 0.09
98 0.08
99 0.09
100 0.09
101 0.1
102 0.09
103 0.1
104 0.1
105 0.14
106 0.19
107 0.19
108 0.2
109 0.19
110 0.19
111 0.21
112 0.28
113 0.27
114 0.22
115 0.23
116 0.22
117 0.21
118 0.22
119 0.18
120 0.12
121 0.11
122 0.12
123 0.1
124 0.15
125 0.16
126 0.16
127 0.16
128 0.18
129 0.17
130 0.16
131 0.17
132 0.12
133 0.12
134 0.11
135 0.11
136 0.11
137 0.13
138 0.14
139 0.15
140 0.16
141 0.17
142 0.21
143 0.23
144 0.25
145 0.26
146 0.29
147 0.33
148 0.38
149 0.4
150 0.41
151 0.39
152 0.36
153 0.32
154 0.32
155 0.25
156 0.19
157 0.15
158 0.11
159 0.1
160 0.1
161 0.09
162 0.05
163 0.05
164 0.05
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.03
172 0.03
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.05
180 0.05
181 0.06
182 0.08
183 0.09
184 0.17
185 0.19
186 0.21
187 0.24
188 0.26
189 0.24
190 0.23
191 0.24
192 0.17
193 0.16
194 0.16
195 0.15
196 0.15
197 0.16
198 0.16
199 0.15
200 0.16
201 0.12
202 0.14
203 0.12
204 0.13
205 0.17
206 0.18
207 0.18
208 0.19
209 0.2
210 0.19
211 0.23
212 0.3
213 0.31
214 0.38
215 0.44
216 0.48
217 0.47
218 0.46
219 0.43
220 0.38
221 0.36
222 0.3
223 0.24
224 0.21
225 0.21
226 0.2
227 0.19
228 0.15
229 0.12
230 0.1
231 0.08
232 0.06
233 0.06
234 0.06
235 0.06
236 0.06
237 0.05
238 0.05
239 0.06
240 0.07
241 0.07
242 0.07
243 0.09
244 0.1
245 0.15
246 0.24
247 0.33
248 0.4
249 0.49
250 0.54
251 0.61
252 0.68
253 0.72
254 0.73
255 0.72
256 0.74
257 0.74
258 0.74
259 0.67
260 0.61
261 0.58
262 0.54
263 0.46
264 0.37
265 0.37
266 0.36
267 0.36
268 0.36
269 0.32
270 0.29
271 0.28
272 0.27
273 0.2
274 0.17
275 0.18
276 0.23
277 0.25
278 0.24
279 0.25
280 0.25
281 0.26
282 0.26
283 0.27
284 0.21
285 0.17
286 0.19
287 0.21
288 0.23
289 0.23
290 0.24
291 0.28
292 0.37
293 0.47
294 0.55
295 0.63
296 0.69
297 0.77
298 0.86
299 0.89
300 0.9
301 0.91
302 0.92
303 0.91
304 0.94
305 0.93
306 0.91
307 0.82
308 0.78
309 0.77
310 0.77
311 0.76
312 0.7
313 0.67
314 0.6
315 0.63
316 0.66
317 0.61
318 0.61
319 0.53
320 0.51
321 0.46
322 0.45
323 0.4
324 0.35
325 0.3
326 0.21
327 0.19
328 0.16
329 0.16
330 0.15
331 0.14
332 0.1
333 0.09
334 0.08
335 0.07
336 0.08
337 0.08
338 0.09
339 0.09