Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0LXG7

Protein Details
Accession A0A2X0LXG7    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-33HTAHNQTRKAHRNGIKKPKTNKYPSLKHydrophilic
NLS Segment(s)
PositionSequence
14-41RKAHRNGIKKPKTNKYPSLKGVDPKFRR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQTRKAHRNGIKKPKTNKYPSLKGVDPKFRRNARHAAMGTQKGALCRAQLEQAVPRARERRVDDGTHSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.75
3 0.75
4 0.72
5 0.73
6 0.75
7 0.8
8 0.8
9 0.79
10 0.83
11 0.83
12 0.85
13 0.82
14 0.81
15 0.78
16 0.77
17 0.73
18 0.7
19 0.63
20 0.6
21 0.58
22 0.59
23 0.54
24 0.52
25 0.55
26 0.53
27 0.54
28 0.53
29 0.54
30 0.47
31 0.51
32 0.46
33 0.42
34 0.43
35 0.41
36 0.37
37 0.31
38 0.29
39 0.22
40 0.23
41 0.18
42 0.13
43 0.12
44 0.13
45 0.14
46 0.14
47 0.16
48 0.18
49 0.25
50 0.3
51 0.3
52 0.35
53 0.37
54 0.38
55 0.44
56 0.46
57 0.48
58 0.48
59 0.51