Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0MH79

Protein Details
Accession A0A2X0MH79   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
108-127HSCYRPRKTGERKRKSVRGCBasic
206-239QRLVTPERLQRRRHQRSLKRRKTEQQKVQVEEYKHydrophilic
NLS Segment(s)
PositionSequence
114-122RKTGERKRK
160-169LGPKRATKIR
186-227RREVVPKKEGAKPYTKAPKIQRLVTPERLQRRRHQRSLKRRK
256-259AKKA
Subcellular Location(s) nucl 16.5, cyto_nucl 12.833, mito_nucl 10.666, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKLNFANPATGQQKTIEIDDERKVRIFYEKRMAQEVAIDSLGDEFKGYVVRITGGNDVHCRHTHTASNLEPDELIISFTARFTQKQGFPMKQGVLVPHRVKLLLSKGHSCYRPRKTGERKRKSVRGCIVGADIRALALVVVKQGESDIPGLTDTVLPKRLGPKRATKIRRFFNLEKTDDVRKFVIRREVVPKKEGAKPYTKAPKIQRLVTPERLQRRRHQRSLKRRKTEQQKVQVEEYKQILAKRLAERKESAAVAKKAKNINRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.25
4 0.25
5 0.28
6 0.33
7 0.36
8 0.34
9 0.34
10 0.32
11 0.29
12 0.36
13 0.36
14 0.37
15 0.44
16 0.46
17 0.47
18 0.52
19 0.51
20 0.41
21 0.41
22 0.35
23 0.27
24 0.23
25 0.2
26 0.14
27 0.15
28 0.15
29 0.1
30 0.08
31 0.06
32 0.06
33 0.08
34 0.08
35 0.07
36 0.08
37 0.09
38 0.1
39 0.12
40 0.15
41 0.15
42 0.17
43 0.2
44 0.21
45 0.24
46 0.24
47 0.27
48 0.27
49 0.29
50 0.31
51 0.31
52 0.36
53 0.34
54 0.39
55 0.34
56 0.31
57 0.28
58 0.23
59 0.21
60 0.14
61 0.12
62 0.06
63 0.06
64 0.06
65 0.06
66 0.1
67 0.1
68 0.1
69 0.13
70 0.2
71 0.22
72 0.29
73 0.36
74 0.34
75 0.36
76 0.4
77 0.37
78 0.33
79 0.31
80 0.28
81 0.25
82 0.3
83 0.29
84 0.26
85 0.26
86 0.24
87 0.23
88 0.22
89 0.25
90 0.23
91 0.24
92 0.26
93 0.29
94 0.34
95 0.38
96 0.4
97 0.44
98 0.45
99 0.51
100 0.51
101 0.58
102 0.64
103 0.71
104 0.77
105 0.78
106 0.8
107 0.8
108 0.84
109 0.78
110 0.76
111 0.71
112 0.65
113 0.55
114 0.47
115 0.41
116 0.34
117 0.29
118 0.2
119 0.14
120 0.08
121 0.07
122 0.06
123 0.04
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.06
139 0.07
140 0.07
141 0.09
142 0.11
143 0.11
144 0.12
145 0.21
146 0.26
147 0.31
148 0.34
149 0.42
150 0.49
151 0.59
152 0.67
153 0.68
154 0.71
155 0.72
156 0.75
157 0.74
158 0.68
159 0.68
160 0.67
161 0.6
162 0.56
163 0.52
164 0.52
165 0.45
166 0.44
167 0.35
168 0.31
169 0.31
170 0.32
171 0.37
172 0.31
173 0.34
174 0.42
175 0.49
176 0.48
177 0.49
178 0.48
179 0.43
180 0.49
181 0.5
182 0.44
183 0.44
184 0.42
185 0.49
186 0.56
187 0.55
188 0.55
189 0.58
190 0.63
191 0.61
192 0.64
193 0.6
194 0.57
195 0.62
196 0.63
197 0.62
198 0.59
199 0.65
200 0.67
201 0.67
202 0.69
203 0.73
204 0.75
205 0.78
206 0.82
207 0.82
208 0.86
209 0.92
210 0.93
211 0.92
212 0.91
213 0.91
214 0.91
215 0.91
216 0.9
217 0.89
218 0.87
219 0.82
220 0.81
221 0.77
222 0.68
223 0.62
224 0.54
225 0.47
226 0.41
227 0.38
228 0.36
229 0.33
230 0.38
231 0.42
232 0.47
233 0.48
234 0.5
235 0.52
236 0.5
237 0.52
238 0.47
239 0.44
240 0.45
241 0.47
242 0.5
243 0.51
244 0.54
245 0.57