Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0MBI4

Protein Details
Accession A0A2X0MBI4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-106STCCRVTLKRSTARIRSKKKTNHCSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010285  DNA_helicase_pif1-like  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003678  F:DNA helicase activity  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
GO:0000723  P:telomere maintenance  
Pfam View protein in Pfam  
PF05970  PIF1  
Amino Acid Sequences MNCGSPSRGRSSTARFGGVTVVLAGDSKQCLPVIPKSSPTQIVDACIMNADFWGEVEVLHLSFEQIWRPKFRTWIRSTTWCSTCCRVTLKRSTARIRSKKKTNHCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.39
3 0.38
4 0.35
5 0.3
6 0.22
7 0.13
8 0.1
9 0.07
10 0.07
11 0.07
12 0.06
13 0.07
14 0.07
15 0.08
16 0.08
17 0.09
18 0.12
19 0.18
20 0.22
21 0.23
22 0.26
23 0.28
24 0.3
25 0.33
26 0.31
27 0.28
28 0.23
29 0.23
30 0.21
31 0.18
32 0.15
33 0.12
34 0.11
35 0.07
36 0.07
37 0.05
38 0.04
39 0.03
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.05
50 0.05
51 0.09
52 0.13
53 0.16
54 0.2
55 0.23
56 0.25
57 0.34
58 0.4
59 0.46
60 0.47
61 0.52
62 0.54
63 0.59
64 0.63
65 0.62
66 0.6
67 0.52
68 0.51
69 0.48
70 0.45
71 0.4
72 0.4
73 0.38
74 0.42
75 0.5
76 0.54
77 0.58
78 0.65
79 0.7
80 0.73
81 0.79
82 0.82
83 0.82
84 0.83
85 0.85
86 0.87