Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0PAB3

Protein Details
Accession A0A2X0PAB3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
101-121ALSSHPFVSQKRKRTPPRSRTHydrophilic
NLS Segment(s)
PositionSequence
112-118RKRTPPR
Subcellular Location(s) mito 16, extr 5, cyto 3, plas 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MALPVLKWFISSSPPLVKGFLLKASFCPLSDTANPCITYAERLAKIGLMGATASNPLSAFTVQVLQLVESGWAADPSSVNGMMAQGMDDYYERCGWGDSGALSSHPFVSQKRKRTPPRSRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.28
4 0.27
5 0.26
6 0.25
7 0.26
8 0.23
9 0.2
10 0.21
11 0.25
12 0.25
13 0.22
14 0.24
15 0.19
16 0.22
17 0.26
18 0.28
19 0.26
20 0.3
21 0.3
22 0.26
23 0.27
24 0.23
25 0.2
26 0.2
27 0.21
28 0.17
29 0.18
30 0.17
31 0.16
32 0.15
33 0.14
34 0.11
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.06
50 0.07
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.07
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.07
78 0.08
79 0.08
80 0.08
81 0.09
82 0.09
83 0.09
84 0.1
85 0.08
86 0.1
87 0.1
88 0.1
89 0.11
90 0.11
91 0.11
92 0.12
93 0.14
94 0.16
95 0.27
96 0.35
97 0.44
98 0.53
99 0.63
100 0.73
101 0.82