Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0NUU7

Protein Details
Accession A0A2X0NUU7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSRTKCSRKRMCRVPETQTGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MSRTKCSRKRMCRVPETQTGSWATAAAASLSVKILGLRCEESTLRSAQDLGARSEPGADLGARSEPGAPAQDLGAQSEAGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.78
4 0.68
5 0.61
6 0.53
7 0.44
8 0.37
9 0.3
10 0.2
11 0.12
12 0.12
13 0.08
14 0.06
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.07
23 0.08
24 0.09
25 0.09
26 0.11
27 0.11
28 0.12
29 0.13
30 0.13
31 0.12
32 0.11
33 0.11
34 0.1
35 0.14
36 0.14
37 0.15
38 0.15
39 0.15
40 0.15
41 0.15
42 0.14
43 0.11
44 0.1
45 0.08
46 0.06
47 0.07
48 0.09
49 0.08
50 0.09
51 0.09
52 0.08
53 0.1
54 0.12
55 0.11
56 0.11
57 0.11
58 0.14
59 0.14
60 0.16
61 0.15