Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4R0Y8

Protein Details
Accession C4R0Y8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-29SQEAANKKKQKKIDDVKFPKIFKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002483  PWI_dom  
IPR036483  PWI_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
KEGG ppa:PAS_chr2-1_0528  -  
Pfam View protein in Pfam  
PF01480  PWI  
PROSITE View protein in PROSITE  
PS51025  PWI  
Amino Acid Sequences MSVVPISQEAANKKKQKKIDDVKFPKIFKKSVDLKMVDLEVINSWVKGTIEKLLGTDDDIVINFINEMLVDELDIKEIYLQLKGFLEDQTLPFCTELWELLLEAQESRDGIPEKLKKNHNRIVNANRPRSGRYTDRRVRSDSRYRRHYREDGETRARVGDTKRNERSHRDYSPSRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.68
4 0.72
5 0.77
6 0.78
7 0.8
8 0.82
9 0.84
10 0.84
11 0.78
12 0.74
13 0.69
14 0.61
15 0.52
16 0.53
17 0.51
18 0.51
19 0.57
20 0.51
21 0.47
22 0.47
23 0.44
24 0.35
25 0.26
26 0.19
27 0.12
28 0.13
29 0.11
30 0.09
31 0.08
32 0.09
33 0.09
34 0.09
35 0.1
36 0.11
37 0.12
38 0.13
39 0.13
40 0.13
41 0.13
42 0.13
43 0.12
44 0.09
45 0.08
46 0.08
47 0.08
48 0.07
49 0.06
50 0.05
51 0.04
52 0.04
53 0.03
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.06
61 0.05
62 0.05
63 0.04
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.09
72 0.08
73 0.09
74 0.08
75 0.09
76 0.09
77 0.1
78 0.1
79 0.09
80 0.09
81 0.08
82 0.08
83 0.08
84 0.07
85 0.06
86 0.06
87 0.06
88 0.07
89 0.06
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.08
96 0.09
97 0.1
98 0.17
99 0.24
100 0.29
101 0.36
102 0.45
103 0.5
104 0.58
105 0.63
106 0.63
107 0.63
108 0.65
109 0.68
110 0.69
111 0.7
112 0.66
113 0.65
114 0.59
115 0.56
116 0.52
117 0.49
118 0.48
119 0.47
120 0.53
121 0.57
122 0.63
123 0.64
124 0.66
125 0.66
126 0.66
127 0.69
128 0.68
129 0.69
130 0.72
131 0.75
132 0.76
133 0.79
134 0.77
135 0.73
136 0.73
137 0.72
138 0.7
139 0.7
140 0.65
141 0.57
142 0.51
143 0.45
144 0.38
145 0.35
146 0.35
147 0.36
148 0.45
149 0.53
150 0.6
151 0.65
152 0.7
153 0.74
154 0.74
155 0.72
156 0.7
157 0.71