Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0N0X8

Protein Details
Accession A0A2X0N0X8    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
173-203EKALPKTPKVKRKPGRPKGSKNKYKKGQWTDBasic
241-270RTPTPPPPPPPPKRRGRPPKPKDPNAPPTABasic
NLS Segment(s)
PositionSequence
162-198LKFKSRIASRAEKALPKTPKVKRKPGRPKGSKNKYKK
245-284PPPPPPPPKRRGRPPKPKDPNAPPTAAKKAKAPAKRRVKR
Subcellular Location(s) nucl 17, cyto_nucl 13.333, mito_nucl 9.333, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019481  TFIIIC_triple_barrel  
Pfam View protein in Pfam  
PF10419  TFIIIC_sub6  
Amino Acid Sequences MPFTSAADCVDPPLVDRTWTRVERLEPREHQVNDADDSDEWEQDEVTYLTLDFGAKLAVETLNQERGHIQLLGLESSTPYARVGPQFYQGQHETLIGDQMLLQHHPETETSPSHYVPLPSTSTSRIYFQPVSIKPKEDPVPVIDPKNHTTPIPASLLMTGKLKFKSRIASRAEKALPKTPKVKRKPGRPKGSKNKYKKGQWTDEEHVEHANDEEGMLPALPTLEMDDPEELERRSSLQGGRTPTPPPPPPPPKRRGRPPKPKDPNAPPTAAKKAKAPAKRRVKRIESDATLDSSDFGEGRMDVDEASEEEYVRSNVDTCSNAAAGESTRRVPRRSAATAATAAVAIAVSGGEQLVISDDEENEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.24
5 0.31
6 0.33
7 0.35
8 0.35
9 0.42
10 0.49
11 0.55
12 0.58
13 0.54
14 0.59
15 0.64
16 0.6
17 0.56
18 0.51
19 0.47
20 0.4
21 0.37
22 0.32
23 0.23
24 0.26
25 0.24
26 0.2
27 0.17
28 0.14
29 0.13
30 0.11
31 0.14
32 0.1
33 0.09
34 0.09
35 0.08
36 0.08
37 0.09
38 0.09
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.1
48 0.13
49 0.2
50 0.2
51 0.21
52 0.2
53 0.21
54 0.23
55 0.19
56 0.16
57 0.12
58 0.13
59 0.13
60 0.13
61 0.11
62 0.09
63 0.11
64 0.11
65 0.09
66 0.08
67 0.09
68 0.11
69 0.15
70 0.19
71 0.19
72 0.24
73 0.28
74 0.28
75 0.33
76 0.31
77 0.29
78 0.25
79 0.24
80 0.19
81 0.15
82 0.16
83 0.1
84 0.08
85 0.08
86 0.09
87 0.09
88 0.09
89 0.1
90 0.09
91 0.1
92 0.11
93 0.11
94 0.11
95 0.13
96 0.14
97 0.17
98 0.19
99 0.19
100 0.2
101 0.21
102 0.2
103 0.18
104 0.19
105 0.18
106 0.17
107 0.19
108 0.2
109 0.22
110 0.22
111 0.23
112 0.21
113 0.24
114 0.23
115 0.23
116 0.29
117 0.3
118 0.36
119 0.36
120 0.37
121 0.32
122 0.38
123 0.4
124 0.33
125 0.3
126 0.27
127 0.32
128 0.32
129 0.34
130 0.3
131 0.3
132 0.31
133 0.33
134 0.29
135 0.22
136 0.22
137 0.21
138 0.22
139 0.2
140 0.17
141 0.14
142 0.15
143 0.16
144 0.14
145 0.14
146 0.12
147 0.14
148 0.16
149 0.18
150 0.19
151 0.2
152 0.27
153 0.29
154 0.36
155 0.39
156 0.44
157 0.43
158 0.48
159 0.48
160 0.43
161 0.42
162 0.42
163 0.39
164 0.35
165 0.44
166 0.44
167 0.51
168 0.55
169 0.64
170 0.64
171 0.72
172 0.8
173 0.81
174 0.85
175 0.85
176 0.88
177 0.88
178 0.92
179 0.9
180 0.88
181 0.88
182 0.85
183 0.83
184 0.82
185 0.79
186 0.77
187 0.72
188 0.7
189 0.65
190 0.62
191 0.55
192 0.46
193 0.38
194 0.3
195 0.25
196 0.17
197 0.13
198 0.07
199 0.06
200 0.05
201 0.05
202 0.05
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.03
209 0.05
210 0.05
211 0.06
212 0.07
213 0.07
214 0.08
215 0.1
216 0.11
217 0.1
218 0.1
219 0.09
220 0.1
221 0.11
222 0.13
223 0.14
224 0.18
225 0.22
226 0.26
227 0.29
228 0.29
229 0.3
230 0.31
231 0.37
232 0.35
233 0.36
234 0.42
235 0.5
236 0.57
237 0.65
238 0.7
239 0.74
240 0.8
241 0.86
242 0.87
243 0.88
244 0.89
245 0.89
246 0.91
247 0.91
248 0.91
249 0.89
250 0.88
251 0.86
252 0.8
253 0.75
254 0.67
255 0.62
256 0.63
257 0.57
258 0.48
259 0.43
260 0.45
261 0.49
262 0.55
263 0.56
264 0.57
265 0.65
266 0.71
267 0.76
268 0.79
269 0.79
270 0.76
271 0.77
272 0.76
273 0.68
274 0.64
275 0.56
276 0.48
277 0.41
278 0.34
279 0.27
280 0.18
281 0.15
282 0.1
283 0.09
284 0.08
285 0.07
286 0.08
287 0.08
288 0.08
289 0.07
290 0.08
291 0.08
292 0.08
293 0.1
294 0.09
295 0.09
296 0.09
297 0.11
298 0.11
299 0.11
300 0.11
301 0.1
302 0.11
303 0.14
304 0.15
305 0.15
306 0.17
307 0.16
308 0.16
309 0.15
310 0.15
311 0.13
312 0.17
313 0.18
314 0.2
315 0.27
316 0.32
317 0.35
318 0.37
319 0.43
320 0.46
321 0.49
322 0.5
323 0.45
324 0.46
325 0.45
326 0.41
327 0.34
328 0.25
329 0.2
330 0.14
331 0.11
332 0.06
333 0.04
334 0.03
335 0.03
336 0.03
337 0.03
338 0.03
339 0.03
340 0.04
341 0.06
342 0.06
343 0.07
344 0.09