Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CQH6

Protein Details
Accession A1CQH6   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
138-160EAPGGKKTKSKGKRNARRDSDAMBasic
NLS Segment(s)
PositionSequence
140-155PGGKKTKSKGKRNARR
Subcellular Location(s) nucl 13, mito_nucl 11.166, cyto_nucl 9.666, mito 8, cyto_mito 7.166, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0003743  F:translation initiation factor activity  
GO:0006366  P:transcription by RNA polymerase II  
KEGG act:ACLA_026140  -  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MAEPRARAARHKGQMNFASELRLLLLAYGDPSPHPSFPSEPLPETVRVLDEIVTDFVLEMCHNAAQYASYSRRQKIKVDDFRFALRRDPNKLGRVQELLRMERELKEARKAFDQNDDQVGNLKDAGKKGLDELGEGAEAPGGKKTKSKGKRNARRDSDAMEDTVSKKRKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.58
4 0.48
5 0.43
6 0.35
7 0.31
8 0.23
9 0.18
10 0.13
11 0.09
12 0.09
13 0.06
14 0.07
15 0.08
16 0.07
17 0.07
18 0.13
19 0.15
20 0.15
21 0.17
22 0.18
23 0.2
24 0.24
25 0.31
26 0.29
27 0.28
28 0.3
29 0.32
30 0.3
31 0.29
32 0.25
33 0.19
34 0.16
35 0.15
36 0.13
37 0.1
38 0.1
39 0.09
40 0.08
41 0.07
42 0.07
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.1
55 0.13
56 0.19
57 0.23
58 0.27
59 0.33
60 0.35
61 0.38
62 0.44
63 0.51
64 0.55
65 0.55
66 0.55
67 0.51
68 0.53
69 0.51
70 0.42
71 0.37
72 0.33
73 0.32
74 0.34
75 0.39
76 0.4
77 0.41
78 0.43
79 0.4
80 0.36
81 0.36
82 0.31
83 0.31
84 0.29
85 0.26
86 0.24
87 0.23
88 0.22
89 0.19
90 0.23
91 0.22
92 0.2
93 0.27
94 0.29
95 0.29
96 0.34
97 0.35
98 0.33
99 0.37
100 0.38
101 0.32
102 0.34
103 0.32
104 0.26
105 0.29
106 0.28
107 0.2
108 0.18
109 0.18
110 0.16
111 0.16
112 0.18
113 0.15
114 0.14
115 0.15
116 0.17
117 0.15
118 0.13
119 0.13
120 0.12
121 0.12
122 0.11
123 0.1
124 0.08
125 0.08
126 0.07
127 0.11
128 0.12
129 0.12
130 0.16
131 0.22
132 0.32
133 0.42
134 0.52
135 0.58
136 0.69
137 0.79
138 0.85
139 0.91
140 0.89
141 0.86
142 0.79
143 0.74
144 0.7
145 0.61
146 0.52
147 0.42
148 0.36
149 0.32
150 0.37