Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0LS51

Protein Details
Accession A0A2X0LS51    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
116-139LIKESQKRYLKKKGVNPKALNGKPHydrophilic
NLS Segment(s)
PositionSequence
123-142RYLKKKGVNPKALNGKPSKA
Subcellular Location(s) cyto 15, cyto_nucl 11.5, nucl 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001678  MeTrfase_RsmB/NOP2  
IPR023267  RCMT  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0003723  F:RNA binding  
GO:0008173  F:RNA methyltransferase activity  
GO:0008757  F:S-adenosylmethionine-dependent methyltransferase activity  
Pfam View protein in Pfam  
PF01189  Methyltr_RsmB-F  
PROSITE View protein in PROSITE  
PS51686  SAM_MT_RSMB_NOP  
Amino Acid Sequences MTEENEAVVSYALRKRPHVKLVETGLQFGKKGFKSYKGKVFGKNMHLTRRFYPHVHNMDGFYVAKFKVGKPDKKAIALAEQEENEVSEYKPLGEEEDEDEDGKGEPKFDDEQDEALIKESQKRYLKKKGVNPKALNGKPSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.36
3 0.43
4 0.52
5 0.53
6 0.52
7 0.54
8 0.58
9 0.6
10 0.54
11 0.49
12 0.43
13 0.38
14 0.34
15 0.28
16 0.28
17 0.21
18 0.26
19 0.27
20 0.33
21 0.41
22 0.48
23 0.56
24 0.57
25 0.61
26 0.62
27 0.67
28 0.64
29 0.63
30 0.64
31 0.59
32 0.59
33 0.59
34 0.56
35 0.51
36 0.51
37 0.47
38 0.41
39 0.42
40 0.42
41 0.42
42 0.41
43 0.38
44 0.33
45 0.3
46 0.3
47 0.25
48 0.15
49 0.12
50 0.1
51 0.11
52 0.11
53 0.1
54 0.18
55 0.25
56 0.31
57 0.34
58 0.42
59 0.41
60 0.42
61 0.43
62 0.34
63 0.32
64 0.28
65 0.24
66 0.19
67 0.17
68 0.16
69 0.15
70 0.14
71 0.1
72 0.09
73 0.08
74 0.07
75 0.07
76 0.07
77 0.08
78 0.07
79 0.08
80 0.08
81 0.09
82 0.11
83 0.14
84 0.15
85 0.14
86 0.14
87 0.13
88 0.13
89 0.14
90 0.11
91 0.09
92 0.08
93 0.11
94 0.13
95 0.14
96 0.18
97 0.18
98 0.19
99 0.2
100 0.2
101 0.17
102 0.17
103 0.19
104 0.15
105 0.21
106 0.22
107 0.29
108 0.37
109 0.44
110 0.5
111 0.59
112 0.68
113 0.69
114 0.77
115 0.8
116 0.82
117 0.86
118 0.82
119 0.8
120 0.82
121 0.76
122 0.74