Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0MFW9

Protein Details
Accession A0A2X0MFW9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-26AATTIPRIKKRTKPFIRHQSDRYAGHydrophilic
28-47KAAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-50IKKRTKPFIRHQSDRYAGVKAAWRKPKGIDNRVRRRFKGQLP
Subcellular Location(s) nucl 10.5, mito_nucl 10.5, mito 9.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAATTIPRIKKRTKPFIRHQSDRYAGVKAAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHVMPNGYRRFLVNNTRELELLLMHNGSYAAEIAHGVSSRKRVEIVEKARVLGVKLTNGNARVRTEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.88
4 0.9
5 0.88
6 0.82
7 0.8
8 0.73
9 0.68
10 0.59
11 0.5
12 0.41
13 0.35
14 0.38
15 0.35
16 0.4
17 0.43
18 0.43
19 0.43
20 0.46
21 0.52
22 0.55
23 0.58
24 0.59
25 0.62
26 0.71
27 0.79
28 0.82
29 0.76
30 0.73
31 0.71
32 0.67
33 0.67
34 0.64
35 0.64
36 0.63
37 0.65
38 0.59
39 0.52
40 0.46
41 0.37
42 0.37
43 0.33
44 0.35
45 0.4
46 0.41
47 0.41
48 0.45
49 0.47
50 0.47
51 0.46
52 0.47
53 0.46
54 0.54
55 0.56
56 0.53
57 0.49
58 0.42
59 0.39
60 0.35
61 0.36
62 0.28
63 0.31
64 0.32
65 0.32
66 0.32
67 0.29
68 0.25
69 0.17
70 0.14
71 0.09
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.06
84 0.06
85 0.07
86 0.09
87 0.15
88 0.16
89 0.17
90 0.18
91 0.18
92 0.25
93 0.34
94 0.39
95 0.43
96 0.42
97 0.42
98 0.43
99 0.42
100 0.36
101 0.31
102 0.27
103 0.23
104 0.24
105 0.26
106 0.29
107 0.32
108 0.35
109 0.33
110 0.33