Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0P8R3

Protein Details
Accession A0A2X0P8R3   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
272-299SGVRGAGPPRNKKKKTEHNPNRSQQTNPHydrophilic
NLS Segment(s)
PositionSequence
276-287GAGPPRNKKKKT
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
Amino Acid Sequences MAGSASEKDRENQRRNGKGTARKYIDADGMYARKDKGNMGLRDYTCKRGQIDKIYYNWVRSVVRDALVVAGIRTPTPVQLYGPLAEINQEWSHNHDLPENYDLKDAFRLISAKTSTNTVLWGNLSPSKQREIVKYIRERAGFLAVTSGDWLYEELVIDVLANIRSAWKLAYDREVCRLAGIKGQLSKADIATLRSRHGEGPSRKSQDGVYSASDTGTSDLEEEEVLATRNRALVPKKRGARQGAGSPQLSQETQQTSPHVGSSGQRSTPAASGVRGAGPPRNKKKKTEHNPNRSQQTNPKRDLGNGRAEEEEDEDQGQDEEEVEELERSPRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.78
4 0.76
5 0.76
6 0.76
7 0.77
8 0.73
9 0.66
10 0.64
11 0.58
12 0.54
13 0.44
14 0.38
15 0.33
16 0.3
17 0.29
18 0.29
19 0.27
20 0.25
21 0.25
22 0.26
23 0.29
24 0.36
25 0.37
26 0.4
27 0.47
28 0.46
29 0.54
30 0.55
31 0.52
32 0.46
33 0.47
34 0.44
35 0.44
36 0.5
37 0.5
38 0.56
39 0.55
40 0.54
41 0.59
42 0.58
43 0.52
44 0.46
45 0.4
46 0.32
47 0.28
48 0.31
49 0.25
50 0.24
51 0.22
52 0.21
53 0.18
54 0.18
55 0.16
56 0.11
57 0.09
58 0.09
59 0.08
60 0.1
61 0.09
62 0.1
63 0.12
64 0.13
65 0.12
66 0.15
67 0.17
68 0.17
69 0.17
70 0.16
71 0.14
72 0.14
73 0.13
74 0.13
75 0.12
76 0.12
77 0.12
78 0.16
79 0.21
80 0.22
81 0.23
82 0.23
83 0.23
84 0.25
85 0.29
86 0.26
87 0.22
88 0.22
89 0.21
90 0.18
91 0.19
92 0.17
93 0.13
94 0.12
95 0.13
96 0.11
97 0.17
98 0.17
99 0.17
100 0.17
101 0.19
102 0.18
103 0.17
104 0.18
105 0.13
106 0.13
107 0.12
108 0.12
109 0.12
110 0.15
111 0.16
112 0.17
113 0.18
114 0.2
115 0.24
116 0.26
117 0.27
118 0.3
119 0.35
120 0.4
121 0.45
122 0.47
123 0.47
124 0.45
125 0.42
126 0.37
127 0.35
128 0.26
129 0.2
130 0.16
131 0.12
132 0.11
133 0.11
134 0.09
135 0.05
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.03
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.05
153 0.05
154 0.06
155 0.07
156 0.08
157 0.16
158 0.18
159 0.19
160 0.23
161 0.24
162 0.22
163 0.21
164 0.22
165 0.16
166 0.15
167 0.15
168 0.13
169 0.14
170 0.15
171 0.15
172 0.14
173 0.14
174 0.11
175 0.13
176 0.11
177 0.12
178 0.16
179 0.16
180 0.17
181 0.18
182 0.19
183 0.18
184 0.21
185 0.28
186 0.3
187 0.36
188 0.43
189 0.46
190 0.45
191 0.45
192 0.42
193 0.37
194 0.34
195 0.29
196 0.23
197 0.2
198 0.2
199 0.19
200 0.18
201 0.14
202 0.12
203 0.09
204 0.07
205 0.06
206 0.06
207 0.06
208 0.06
209 0.05
210 0.05
211 0.05
212 0.06
213 0.06
214 0.06
215 0.06
216 0.08
217 0.09
218 0.14
219 0.2
220 0.28
221 0.36
222 0.44
223 0.5
224 0.54
225 0.61
226 0.61
227 0.61
228 0.57
229 0.57
230 0.56
231 0.54
232 0.49
233 0.42
234 0.38
235 0.34
236 0.3
237 0.22
238 0.2
239 0.19
240 0.2
241 0.22
242 0.22
243 0.23
244 0.23
245 0.22
246 0.19
247 0.16
248 0.17
249 0.22
250 0.25
251 0.23
252 0.24
253 0.24
254 0.25
255 0.25
256 0.26
257 0.2
258 0.16
259 0.17
260 0.17
261 0.18
262 0.17
263 0.18
264 0.21
265 0.28
266 0.38
267 0.48
268 0.58
269 0.6
270 0.68
271 0.77
272 0.82
273 0.85
274 0.86
275 0.86
276 0.86
277 0.92
278 0.92
279 0.9
280 0.82
281 0.78
282 0.77
283 0.77
284 0.75
285 0.69
286 0.66
287 0.59
288 0.63
289 0.65
290 0.61
291 0.6
292 0.53
293 0.51
294 0.46
295 0.45
296 0.4
297 0.34
298 0.3
299 0.21
300 0.19
301 0.16
302 0.16
303 0.15
304 0.14
305 0.1
306 0.09
307 0.08
308 0.07
309 0.08
310 0.08
311 0.09
312 0.09