Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0MG77

Protein Details
Accession A0A2X0MG77    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-61FCAIRRERKGRGMKRNWRGGTCHydrophilic
NLS Segment(s)
PositionSequence
45-54RERKGRGMKR
Subcellular Location(s) nucl 10, cyto_nucl 9.833, mito_nucl 9.833, mito 8.5, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MRKWKIWRKGWGRAHNDEKGLKKGCDSVYRTQDRQLCSFFCAIRRERKGRGMKRNWRGGTCALEIYALSGFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.73
3 0.7
4 0.64
5 0.58
6 0.56
7 0.52
8 0.43
9 0.37
10 0.37
11 0.36
12 0.38
13 0.39
14 0.39
15 0.44
16 0.49
17 0.48
18 0.49
19 0.49
20 0.44
21 0.41
22 0.36
23 0.27
24 0.24
25 0.25
26 0.2
27 0.21
28 0.24
29 0.25
30 0.32
31 0.39
32 0.43
33 0.45
34 0.54
35 0.6
36 0.65
37 0.72
38 0.74
39 0.76
40 0.81
41 0.86
42 0.81
43 0.73
44 0.67
45 0.61
46 0.55
47 0.47
48 0.39
49 0.29
50 0.25
51 0.22
52 0.2