Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0M656

Protein Details
Accession A0A2X0M656   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
82-107AISKSAPSPRRSKRKREESFFKTARLHydrophilic
NLS Segment(s)
PositionSequence
87-100APSPRRSKRKREES
Subcellular Location(s) nucl 22.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MYTSERNPDAQCTSPLISRSPRPNPAPSIATIGSMPDAPPMRLPTVVRFDPTPPLPVSEALEVVACLPRYQRCTLAVRPIAAISKSAPSPRRSKRKREESFFKTARLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.3
4 0.31
5 0.35
6 0.42
7 0.45
8 0.5
9 0.52
10 0.55
11 0.56
12 0.55
13 0.51
14 0.43
15 0.41
16 0.34
17 0.3
18 0.24
19 0.2
20 0.16
21 0.14
22 0.12
23 0.1
24 0.11
25 0.1
26 0.12
27 0.14
28 0.15
29 0.16
30 0.17
31 0.17
32 0.22
33 0.22
34 0.22
35 0.2
36 0.2
37 0.23
38 0.23
39 0.21
40 0.15
41 0.16
42 0.16
43 0.16
44 0.16
45 0.13
46 0.12
47 0.09
48 0.09
49 0.07
50 0.07
51 0.08
52 0.07
53 0.06
54 0.08
55 0.11
56 0.15
57 0.17
58 0.19
59 0.21
60 0.27
61 0.3
62 0.37
63 0.37
64 0.34
65 0.33
66 0.32
67 0.3
68 0.25
69 0.23
70 0.15
71 0.15
72 0.17
73 0.22
74 0.27
75 0.29
76 0.39
77 0.48
78 0.59
79 0.64
80 0.73
81 0.78
82 0.84
83 0.89
84 0.9
85 0.9
86 0.86
87 0.88
88 0.8