Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0LYA5

Protein Details
Accession A0A2X0LYA5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
112-139GTLNFHRANHAKKKKRFRELRLIIRGRSHydrophilic
NLS Segment(s)
PositionSequence
120-136NHAKKKKRFRELRLIIR
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MPSPEAAARNRSTQRRANWFIKATAPAAGSLNVARQVQRARSFSIFLPPALHTLPIAPHPIATLSLRHPKRSSYEFENSLQSVLFECQLSSCSFTVSCGRIDFVRLRIRVHGTLNFHRANHAKKKKRFRELRLIIRGRSSTARFGTVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.65
3 0.7
4 0.67
5 0.67
6 0.63
7 0.59
8 0.55
9 0.49
10 0.39
11 0.35
12 0.29
13 0.23
14 0.21
15 0.19
16 0.16
17 0.13
18 0.14
19 0.14
20 0.14
21 0.13
22 0.16
23 0.19
24 0.25
25 0.3
26 0.31
27 0.32
28 0.33
29 0.34
30 0.31
31 0.35
32 0.3
33 0.24
34 0.24
35 0.2
36 0.21
37 0.19
38 0.18
39 0.11
40 0.11
41 0.11
42 0.11
43 0.12
44 0.1
45 0.1
46 0.1
47 0.1
48 0.11
49 0.1
50 0.1
51 0.12
52 0.22
53 0.23
54 0.26
55 0.26
56 0.27
57 0.31
58 0.32
59 0.33
60 0.3
61 0.34
62 0.34
63 0.35
64 0.35
65 0.31
66 0.27
67 0.22
68 0.16
69 0.12
70 0.09
71 0.08
72 0.06
73 0.06
74 0.06
75 0.07
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.11
82 0.14
83 0.14
84 0.15
85 0.13
86 0.14
87 0.13
88 0.17
89 0.18
90 0.2
91 0.26
92 0.26
93 0.27
94 0.3
95 0.34
96 0.34
97 0.35
98 0.34
99 0.34
100 0.38
101 0.44
102 0.42
103 0.38
104 0.4
105 0.42
106 0.45
107 0.5
108 0.55
109 0.59
110 0.66
111 0.77
112 0.82
113 0.88
114 0.9
115 0.88
116 0.88
117 0.88
118 0.9
119 0.89
120 0.84
121 0.75
122 0.71
123 0.63
124 0.55
125 0.52
126 0.44
127 0.41
128 0.38