Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0NC57

Protein Details
Accession A0A2X0NC57    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-45RAKVCRPSERARPARCRRQNLYKPHKCHRGNBasic
67-90RAPQATSDRPPRARKRSERVFEDFHydrophilic
NLS Segment(s)
PositionSequence
65-82KRRAPQATSDRPPRARKR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLPGRAPNQHERTCRAKVCRPSERARPARCRRQNLYKPHKCHRGNKELNFSKKEVSWSHAQHQPKRRAPQATSDRPPRARKRSERVFEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.6
3 0.6
4 0.63
5 0.68
6 0.71
7 0.71
8 0.71
9 0.74
10 0.77
11 0.78
12 0.76
13 0.78
14 0.78
15 0.83
16 0.84
17 0.82
18 0.79
19 0.81
20 0.81
21 0.81
22 0.82
23 0.8
24 0.78
25 0.78
26 0.81
27 0.76
28 0.77
29 0.74
30 0.74
31 0.74
32 0.72
33 0.74
34 0.71
35 0.71
36 0.65
37 0.57
38 0.48
39 0.41
40 0.39
41 0.3
42 0.27
43 0.28
44 0.29
45 0.33
46 0.37
47 0.42
48 0.46
49 0.54
50 0.61
51 0.62
52 0.66
53 0.68
54 0.69
55 0.64
56 0.67
57 0.68
58 0.68
59 0.68
60 0.7
61 0.71
62 0.72
63 0.8
64 0.79
65 0.79
66 0.79
67 0.81
68 0.83
69 0.85
70 0.87