Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0MJI6

Protein Details
Accession A0A2X0MJI6   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-98AWARRQAHKKAQRLERERNFHydrophilic
124-144GFSNKEKIRKKVKDHDHQRISBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 7.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013898  Atg43  
Gene Ontology GO:0140580  F:mitochondrion autophagosome adaptor activity  
GO:0000423  P:mitophagy  
Amino Acid Sequences MTSLNPSHFPISSLSSSSSSSSNDDARLHGQAVHQSVSFEPESSSSHHHHYQQKKDSFEPTATATASSSSFAEPSWKGAWARRQAHKKAQRLERERNFQNDGDRDDDQQTKESFNRSSLLEKVGFSNKEKIRKKVKDHDHQRISVPPIPDLRYEQGILMSIRPFLHRVQPTTTTSTTVIPLDTETILVDEDINRLRSDQERHEERKEVQEKTTMVSSALTCEAAKEGLKKGEQTDLFAGPLRFEWGKIVYVIFRDQFIYPLLQGLVWGVGGLWIASLWDWNKSRSDANAGAASATRGTVKKGVSPVSNWLAKFGLKAKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.25
5 0.25
6 0.21
7 0.22
8 0.23
9 0.23
10 0.24
11 0.24
12 0.25
13 0.26
14 0.26
15 0.24
16 0.23
17 0.23
18 0.25
19 0.26
20 0.25
21 0.22
22 0.21
23 0.21
24 0.23
25 0.21
26 0.16
27 0.14
28 0.14
29 0.16
30 0.18
31 0.22
32 0.21
33 0.26
34 0.31
35 0.38
36 0.45
37 0.53
38 0.6
39 0.65
40 0.69
41 0.67
42 0.66
43 0.64
44 0.59
45 0.51
46 0.43
47 0.36
48 0.32
49 0.28
50 0.25
51 0.19
52 0.17
53 0.16
54 0.14
55 0.12
56 0.09
57 0.09
58 0.09
59 0.13
60 0.12
61 0.16
62 0.16
63 0.18
64 0.19
65 0.24
66 0.33
67 0.38
68 0.45
69 0.5
70 0.59
71 0.63
72 0.72
73 0.76
74 0.76
75 0.76
76 0.77
77 0.78
78 0.77
79 0.81
80 0.79
81 0.79
82 0.75
83 0.71
84 0.66
85 0.57
86 0.55
87 0.48
88 0.42
89 0.37
90 0.34
91 0.31
92 0.3
93 0.32
94 0.27
95 0.27
96 0.25
97 0.24
98 0.24
99 0.26
100 0.23
101 0.21
102 0.22
103 0.19
104 0.21
105 0.2
106 0.21
107 0.19
108 0.18
109 0.2
110 0.23
111 0.24
112 0.23
113 0.31
114 0.31
115 0.4
116 0.44
117 0.49
118 0.55
119 0.61
120 0.67
121 0.68
122 0.75
123 0.76
124 0.81
125 0.83
126 0.78
127 0.72
128 0.65
129 0.59
130 0.54
131 0.47
132 0.38
133 0.3
134 0.27
135 0.26
136 0.26
137 0.24
138 0.2
139 0.18
140 0.18
141 0.15
142 0.13
143 0.12
144 0.12
145 0.1
146 0.09
147 0.09
148 0.09
149 0.09
150 0.11
151 0.1
152 0.17
153 0.19
154 0.21
155 0.23
156 0.27
157 0.29
158 0.32
159 0.31
160 0.26
161 0.24
162 0.23
163 0.21
164 0.17
165 0.14
166 0.1
167 0.09
168 0.08
169 0.07
170 0.07
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.04
177 0.06
178 0.08
179 0.09
180 0.08
181 0.09
182 0.11
183 0.15
184 0.19
185 0.23
186 0.3
187 0.37
188 0.42
189 0.45
190 0.47
191 0.45
192 0.51
193 0.51
194 0.45
195 0.39
196 0.39
197 0.36
198 0.34
199 0.35
200 0.24
201 0.19
202 0.18
203 0.16
204 0.13
205 0.13
206 0.11
207 0.09
208 0.09
209 0.09
210 0.09
211 0.1
212 0.11
213 0.13
214 0.17
215 0.18
216 0.19
217 0.2
218 0.27
219 0.26
220 0.27
221 0.26
222 0.23
223 0.23
224 0.25
225 0.23
226 0.16
227 0.16
228 0.17
229 0.14
230 0.13
231 0.15
232 0.14
233 0.15
234 0.15
235 0.15
236 0.13
237 0.15
238 0.18
239 0.16
240 0.15
241 0.16
242 0.15
243 0.16
244 0.16
245 0.15
246 0.12
247 0.13
248 0.13
249 0.1
250 0.1
251 0.09
252 0.08
253 0.06
254 0.06
255 0.04
256 0.04
257 0.04
258 0.04
259 0.03
260 0.03
261 0.03
262 0.04
263 0.07
264 0.07
265 0.14
266 0.16
267 0.19
268 0.22
269 0.25
270 0.28
271 0.27
272 0.34
273 0.3
274 0.32
275 0.33
276 0.3
277 0.28
278 0.25
279 0.23
280 0.16
281 0.14
282 0.14
283 0.12
284 0.15
285 0.19
286 0.2
287 0.25
288 0.3
289 0.35
290 0.35
291 0.36
292 0.41
293 0.43
294 0.47
295 0.41
296 0.38
297 0.35
298 0.32
299 0.33