Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0MFY5

Protein Details
Accession A0A2X0MFY5   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-44KTGLGQPGRKRSRRAARQAKAVKAHydrophilic
NLS Segment(s)
PositionSequence
27-47PGRKRSRRAARQAKAVKAGLR
126-131KKAGKV
194-211IRAERQKKKEEEEAAKKK
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
Amino Acid Sequences MRITPVLPRNHFRKDWQSNVKTGLGQPGRKRSRRAARQAKAVKAGLRPVEQLRPAVRCPTKRYNTKLRSGRGFTAAELKAAGIRRKEALSIGIPVDHRRRNRSEESLKINKERLEAYKQRLVVFPKKAGKVKKGDTEGADKSVEGLKTLAATFPLPAGHKQEGPRAITSEELANKGTAYTALRKARSDQRYAGIRAERQKKKEEEEAAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.72
4 0.7
5 0.66
6 0.67
7 0.62
8 0.54
9 0.46
10 0.45
11 0.41
12 0.43
13 0.46
14 0.52
15 0.59
16 0.63
17 0.67
18 0.68
19 0.72
20 0.76
21 0.81
22 0.81
23 0.78
24 0.83
25 0.85
26 0.8
27 0.75
28 0.68
29 0.6
30 0.52
31 0.51
32 0.44
33 0.38
34 0.36
35 0.32
36 0.35
37 0.32
38 0.33
39 0.31
40 0.31
41 0.3
42 0.36
43 0.39
44 0.39
45 0.45
46 0.52
47 0.57
48 0.62
49 0.68
50 0.7
51 0.7
52 0.75
53 0.75
54 0.7
55 0.69
56 0.65
57 0.6
58 0.53
59 0.47
60 0.38
61 0.38
62 0.32
63 0.25
64 0.2
65 0.18
66 0.16
67 0.18
68 0.21
69 0.14
70 0.15
71 0.17
72 0.17
73 0.17
74 0.15
75 0.15
76 0.13
77 0.14
78 0.13
79 0.13
80 0.13
81 0.16
82 0.21
83 0.23
84 0.25
85 0.29
86 0.33
87 0.37
88 0.42
89 0.47
90 0.47
91 0.48
92 0.53
93 0.55
94 0.54
95 0.5
96 0.48
97 0.4
98 0.36
99 0.32
100 0.27
101 0.28
102 0.31
103 0.33
104 0.35
105 0.35
106 0.35
107 0.36
108 0.38
109 0.37
110 0.35
111 0.37
112 0.39
113 0.42
114 0.47
115 0.48
116 0.49
117 0.5
118 0.51
119 0.52
120 0.5
121 0.48
122 0.45
123 0.47
124 0.41
125 0.36
126 0.31
127 0.23
128 0.21
129 0.21
130 0.18
131 0.13
132 0.12
133 0.09
134 0.1
135 0.11
136 0.1
137 0.07
138 0.08
139 0.07
140 0.08
141 0.1
142 0.1
143 0.12
144 0.17
145 0.19
146 0.22
147 0.24
148 0.3
149 0.33
150 0.34
151 0.34
152 0.31
153 0.29
154 0.26
155 0.25
156 0.24
157 0.21
158 0.2
159 0.19
160 0.17
161 0.16
162 0.15
163 0.14
164 0.11
165 0.12
166 0.16
167 0.23
168 0.3
169 0.32
170 0.34
171 0.4
172 0.48
173 0.52
174 0.52
175 0.48
176 0.49
177 0.54
178 0.55
179 0.56
180 0.52
181 0.52
182 0.56
183 0.63
184 0.63
185 0.61
186 0.68
187 0.67
188 0.68
189 0.71
190 0.71
191 0.71