Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0P2Q4

Protein Details
Accession A0A2X0P2Q4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-98QEMGFNSGKARKKKKKTKTTKDEKQIEDGKBasic
NLS Segment(s)
PositionSequence
76-89GKARKKKKKTKTTK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKRHSGIRTAGQDNLSDHTMEVACSDVVDDRKPQLCKPSSREWRPQSTTYRTWTDERSRRRERTQDAVQEMGFNSGKARKKKKKTKTTKDEKQIEDGKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.2
4 0.17
5 0.16
6 0.15
7 0.13
8 0.11
9 0.09
10 0.08
11 0.07
12 0.08
13 0.09
14 0.1
15 0.12
16 0.13
17 0.15
18 0.21
19 0.23
20 0.24
21 0.3
22 0.35
23 0.39
24 0.44
25 0.51
26 0.55
27 0.6
28 0.69
29 0.65
30 0.68
31 0.67
32 0.66
33 0.62
34 0.58
35 0.55
36 0.49
37 0.47
38 0.41
39 0.39
40 0.39
41 0.41
42 0.43
43 0.47
44 0.53
45 0.58
46 0.61
47 0.66
48 0.69
49 0.66
50 0.67
51 0.66
52 0.64
53 0.59
54 0.54
55 0.48
56 0.4
57 0.35
58 0.3
59 0.22
60 0.15
61 0.14
62 0.19
63 0.26
64 0.34
65 0.45
66 0.51
67 0.63
68 0.74
69 0.83
70 0.87
71 0.92
72 0.94
73 0.94
74 0.95
75 0.95
76 0.95
77 0.93
78 0.85
79 0.83