Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CRI2

Protein Details
Accession A1CRI2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
170-194TMARKWREPMKVKRKIARENRRLGAHydrophilic
NLS Segment(s)
PositionSequence
173-192RKWREPMKVKRKIARENRRL
Subcellular Location(s) mito 14, nucl 9, cyto_nucl 7.5, cyto 4
Family & Domain DBs
KEGG act:ACLA_029860  -  
Amino Acid Sequences MASPLGRLASQSIHITPTPQPTSLAESKLILSALQKFGEVVTFRNLKYDTTNSSTIPFRPILAIFDSPDAAKQALEASPLTVPLRSRNKASTSASASASPESDSGSSPQRDIAARGPRAIKCEIHPSRHNHQSALVRNPFYTTFRVLQGTYQFRDLVGTGIPLRELADETMARKWREPMKVKRKIARENRRLGAWSLMKLHRKGLGEMVEEEEEDGGELEDIEGDIEGGTEGDVESERVGER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.25
4 0.32
5 0.31
6 0.29
7 0.3
8 0.28
9 0.36
10 0.37
11 0.35
12 0.28
13 0.26
14 0.26
15 0.25
16 0.23
17 0.16
18 0.14
19 0.17
20 0.19
21 0.18
22 0.17
23 0.16
24 0.16
25 0.19
26 0.18
27 0.15
28 0.18
29 0.21
30 0.21
31 0.26
32 0.27
33 0.24
34 0.28
35 0.3
36 0.29
37 0.31
38 0.33
39 0.29
40 0.31
41 0.32
42 0.28
43 0.28
44 0.23
45 0.18
46 0.18
47 0.18
48 0.17
49 0.18
50 0.18
51 0.16
52 0.16
53 0.16
54 0.14
55 0.14
56 0.13
57 0.1
58 0.08
59 0.08
60 0.09
61 0.08
62 0.1
63 0.09
64 0.09
65 0.09
66 0.1
67 0.11
68 0.1
69 0.1
70 0.17
71 0.25
72 0.26
73 0.29
74 0.32
75 0.35
76 0.39
77 0.42
78 0.39
79 0.35
80 0.36
81 0.34
82 0.31
83 0.29
84 0.23
85 0.2
86 0.15
87 0.11
88 0.09
89 0.08
90 0.08
91 0.09
92 0.14
93 0.14
94 0.13
95 0.14
96 0.15
97 0.14
98 0.16
99 0.21
100 0.24
101 0.24
102 0.26
103 0.29
104 0.28
105 0.31
106 0.31
107 0.26
108 0.2
109 0.3
110 0.31
111 0.33
112 0.38
113 0.41
114 0.45
115 0.52
116 0.51
117 0.41
118 0.42
119 0.43
120 0.43
121 0.44
122 0.41
123 0.34
124 0.33
125 0.34
126 0.31
127 0.26
128 0.23
129 0.19
130 0.17
131 0.18
132 0.19
133 0.18
134 0.19
135 0.23
136 0.25
137 0.23
138 0.23
139 0.21
140 0.19
141 0.2
142 0.18
143 0.12
144 0.08
145 0.09
146 0.08
147 0.08
148 0.08
149 0.07
150 0.07
151 0.07
152 0.08
153 0.07
154 0.09
155 0.1
156 0.11
157 0.17
158 0.21
159 0.22
160 0.22
161 0.27
162 0.32
163 0.4
164 0.48
165 0.54
166 0.6
167 0.7
168 0.77
169 0.78
170 0.8
171 0.81
172 0.83
173 0.83
174 0.82
175 0.8
176 0.76
177 0.71
178 0.65
179 0.56
180 0.53
181 0.45
182 0.38
183 0.36
184 0.4
185 0.43
186 0.42
187 0.43
188 0.4
189 0.39
190 0.37
191 0.37
192 0.35
193 0.31
194 0.31
195 0.32
196 0.27
197 0.25
198 0.23
199 0.17
200 0.12
201 0.1
202 0.09
203 0.05
204 0.05
205 0.05
206 0.04
207 0.05
208 0.05
209 0.05
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.05
220 0.05
221 0.06
222 0.06