Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A364LE19

Protein Details
Accession A0A364LE19    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
150-180LEKVIKLDEKNKKKRKLKGGRTLKQLKKQGLBasic
NLS Segment(s)
PositionSequence
138-178KRANLKAKAEADLEKVIKLDEKNKKKRKLKGGRTLKQLKKQ
Subcellular Location(s) mito_nucl 12.833, nucl 12.5, mito 11, cyto_nucl 8.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MKPSQPLMARLRLTTKQVNRGYYKGNRTGSMGFFLKSSTYIIEPSKLRTYVVPENLDTFKVSQLLKFFPVSPMLTFYKLTPFVTKSFPPTRTKYTREEDRNGVTISKDRAFNGEDYLDLWEKLNPREHDDWSDKWRLKRANLKAKAEADLEKVIKLDEKNKKKRKLKGGRTLKQLKKQGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.52
4 0.56
5 0.6
6 0.58
7 0.58
8 0.6
9 0.59
10 0.6
11 0.59
12 0.56
13 0.5
14 0.49
15 0.49
16 0.42
17 0.4
18 0.33
19 0.25
20 0.22
21 0.21
22 0.18
23 0.15
24 0.14
25 0.1
26 0.1
27 0.13
28 0.14
29 0.18
30 0.19
31 0.23
32 0.27
33 0.25
34 0.25
35 0.23
36 0.29
37 0.31
38 0.36
39 0.33
40 0.29
41 0.32
42 0.32
43 0.31
44 0.26
45 0.19
46 0.14
47 0.15
48 0.15
49 0.13
50 0.14
51 0.15
52 0.16
53 0.17
54 0.16
55 0.14
56 0.17
57 0.16
58 0.14
59 0.17
60 0.16
61 0.17
62 0.17
63 0.16
64 0.17
65 0.18
66 0.18
67 0.17
68 0.17
69 0.17
70 0.2
71 0.21
72 0.23
73 0.27
74 0.31
75 0.34
76 0.36
77 0.42
78 0.45
79 0.48
80 0.48
81 0.49
82 0.54
83 0.55
84 0.55
85 0.51
86 0.48
87 0.46
88 0.4
89 0.34
90 0.25
91 0.22
92 0.21
93 0.2
94 0.19
95 0.16
96 0.18
97 0.19
98 0.18
99 0.18
100 0.14
101 0.12
102 0.11
103 0.14
104 0.12
105 0.11
106 0.11
107 0.11
108 0.13
109 0.16
110 0.23
111 0.22
112 0.28
113 0.31
114 0.33
115 0.37
116 0.4
117 0.41
118 0.39
119 0.46
120 0.44
121 0.44
122 0.5
123 0.49
124 0.52
125 0.58
126 0.62
127 0.65
128 0.69
129 0.71
130 0.71
131 0.68
132 0.63
133 0.55
134 0.47
135 0.39
136 0.36
137 0.31
138 0.25
139 0.23
140 0.2
141 0.22
142 0.22
143 0.29
144 0.34
145 0.44
146 0.55
147 0.65
148 0.75
149 0.8
150 0.87
151 0.89
152 0.89
153 0.9
154 0.9
155 0.91
156 0.89
157 0.91
158 0.92
159 0.89
160 0.88