Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CI42

Protein Details
Accession A1CI42    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-26EESPAQRAARLRRERREAKIKEBasic
NLS Segment(s)
PositionSequence
13-27ARLRRERREAKIKEG
Subcellular Location(s) plas 9, mito 6, nucl 4, cyto_mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028143  Get2/sif1  
Gene Ontology GO:0016020  C:membrane  
KEGG act:ACLA_050190  -  
Pfam View protein in Pfam  
PF08690  GET2  
Amino Acid Sequences MSSAEESPAQRAARLRRERREAKIKEGGAARLDKITSLSGRTPQSIREETSPIPSPSPSPQPPAPVSMPETGPFPGPPPRQFPGPTASVEDHPPEDLQAQQEYIRSLLRQNGPPPTEPGLDDDPMKLLNTLMSGGIPGGIPGADPSAGGAGLSQANLAGTLGSLGLPPWAANWLGAAARPQTDEEKRDIRTWKVLHVVFAVAMGIYLLLVLGASVATFGSQPPPPATARNPFVLFTTAELLLGGTRIMLSNRGGGLVGPALWIQLFRDVIQDGSIVLFLLGMSAWWTRDWMAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.61
3 0.65
4 0.75
5 0.8
6 0.84
7 0.86
8 0.8
9 0.78
10 0.77
11 0.69
12 0.64
13 0.6
14 0.53
15 0.47
16 0.45
17 0.37
18 0.3
19 0.29
20 0.23
21 0.21
22 0.21
23 0.18
24 0.19
25 0.21
26 0.24
27 0.27
28 0.3
29 0.29
30 0.3
31 0.36
32 0.36
33 0.36
34 0.34
35 0.36
36 0.34
37 0.39
38 0.4
39 0.34
40 0.32
41 0.29
42 0.28
43 0.29
44 0.36
45 0.33
46 0.34
47 0.35
48 0.39
49 0.4
50 0.42
51 0.39
52 0.33
53 0.34
54 0.31
55 0.3
56 0.24
57 0.24
58 0.2
59 0.19
60 0.16
61 0.15
62 0.21
63 0.25
64 0.28
65 0.32
66 0.34
67 0.37
68 0.39
69 0.39
70 0.35
71 0.32
72 0.3
73 0.28
74 0.27
75 0.24
76 0.24
77 0.23
78 0.19
79 0.17
80 0.16
81 0.13
82 0.12
83 0.12
84 0.12
85 0.11
86 0.11
87 0.11
88 0.12
89 0.12
90 0.12
91 0.12
92 0.1
93 0.11
94 0.17
95 0.21
96 0.23
97 0.26
98 0.32
99 0.33
100 0.34
101 0.36
102 0.32
103 0.29
104 0.25
105 0.26
106 0.22
107 0.21
108 0.2
109 0.17
110 0.14
111 0.13
112 0.13
113 0.09
114 0.06
115 0.06
116 0.05
117 0.06
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.04
140 0.04
141 0.03
142 0.03
143 0.04
144 0.04
145 0.03
146 0.02
147 0.02
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.04
157 0.05
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.07
164 0.07
165 0.07
166 0.08
167 0.09
168 0.13
169 0.16
170 0.18
171 0.22
172 0.26
173 0.28
174 0.32
175 0.34
176 0.32
177 0.37
178 0.35
179 0.34
180 0.37
181 0.35
182 0.31
183 0.29
184 0.26
185 0.18
186 0.17
187 0.14
188 0.06
189 0.05
190 0.04
191 0.03
192 0.02
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.03
204 0.03
205 0.04
206 0.07
207 0.08
208 0.1
209 0.12
210 0.15
211 0.16
212 0.2
213 0.25
214 0.29
215 0.31
216 0.34
217 0.34
218 0.32
219 0.32
220 0.3
221 0.26
222 0.2
223 0.2
224 0.15
225 0.13
226 0.13
227 0.11
228 0.09
229 0.09
230 0.07
231 0.04
232 0.04
233 0.05
234 0.06
235 0.08
236 0.09
237 0.12
238 0.12
239 0.12
240 0.12
241 0.11
242 0.12
243 0.11
244 0.1
245 0.08
246 0.07
247 0.07
248 0.07
249 0.08
250 0.07
251 0.11
252 0.12
253 0.12
254 0.14
255 0.15
256 0.15
257 0.16
258 0.15
259 0.1
260 0.1
261 0.1
262 0.07
263 0.06
264 0.05
265 0.04
266 0.05
267 0.04
268 0.04
269 0.06
270 0.07
271 0.08
272 0.08
273 0.1