Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A364KUC9

Protein Details
Accession A0A364KUC9    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
43-71SETQLRSRLKKWRVTKPSRQIRKPAGEQGHydrophilic
NLS Segment(s)
PositionSequence
52-61KKWRVTKPSR
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MKTSIPSDVWEKKKALIARLYKDEEWPLKQVIKQIRTEDFNPSETQLRSRLKKWRVTKPSRQIRKXPAGEQGDNNEEDDEEDGSEGMSPVETRNKNDMKNSTPNTSAAMAIPTPPQSQYSQSENLAITREWYPTDVWVQSQQEQQHVSPQQAVMVTQPEVITTQAWTGSISATSPVMTTTPEQHSSHGSISQINTPVVAQFATHSLPAYDLPTQQQPQQPSPTNSIPPPQTTHVLSPTYVSPTYAMAPISYPQPAPPKTTHWPTGNDFIEPDSNPAAALTMQPTSWYTGLYDTAGANAAYYHGRAVNPVAGYNNPVMQHMPSPQGMGASYQLQTHAHAQTQAQPMTQASGYHGYDEGVSVRPWRRATTSHYTPEYAPGVVRVDRQGRQRRPVSDRKSKESAEEMDLMAQQHQHQEQERLQSMQQSMHPAYQPAQPQHPQYIAAGHPHPLIPHDIYAYAGHEQLLQRPLGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.51
4 0.53
5 0.55
6 0.62
7 0.64
8 0.58
9 0.58
10 0.58
11 0.55
12 0.5
13 0.46
14 0.43
15 0.41
16 0.42
17 0.46
18 0.48
19 0.48
20 0.5
21 0.52
22 0.53
23 0.54
24 0.54
25 0.56
26 0.49
27 0.46
28 0.42
29 0.38
30 0.38
31 0.34
32 0.35
33 0.35
34 0.4
35 0.43
36 0.48
37 0.56
38 0.59
39 0.67
40 0.73
41 0.75
42 0.77
43 0.82
44 0.86
45 0.87
46 0.9
47 0.91
48 0.89
49 0.88
50 0.87
51 0.86
52 0.81
53 0.8
54 0.77
55 0.72
56 0.66
57 0.63
58 0.61
59 0.52
60 0.46
61 0.37
62 0.29
63 0.23
64 0.22
65 0.16
66 0.09
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.06
73 0.05
74 0.05
75 0.08
76 0.17
77 0.19
78 0.23
79 0.32
80 0.38
81 0.41
82 0.48
83 0.51
84 0.49
85 0.57
86 0.57
87 0.52
88 0.48
89 0.46
90 0.41
91 0.36
92 0.3
93 0.21
94 0.18
95 0.14
96 0.14
97 0.15
98 0.15
99 0.15
100 0.15
101 0.17
102 0.16
103 0.21
104 0.24
105 0.27
106 0.29
107 0.28
108 0.3
109 0.28
110 0.28
111 0.25
112 0.21
113 0.17
114 0.16
115 0.16
116 0.13
117 0.14
118 0.14
119 0.14
120 0.17
121 0.16
122 0.15
123 0.2
124 0.22
125 0.23
126 0.27
127 0.27
128 0.27
129 0.29
130 0.28
131 0.3
132 0.29
133 0.27
134 0.24
135 0.23
136 0.21
137 0.19
138 0.19
139 0.12
140 0.12
141 0.12
142 0.11
143 0.11
144 0.09
145 0.1
146 0.1
147 0.09
148 0.07
149 0.07
150 0.06
151 0.07
152 0.07
153 0.07
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.07
164 0.07
165 0.11
166 0.15
167 0.19
168 0.2
169 0.21
170 0.23
171 0.24
172 0.24
173 0.21
174 0.18
175 0.16
176 0.16
177 0.18
178 0.18
179 0.15
180 0.15
181 0.13
182 0.12
183 0.11
184 0.09
185 0.06
186 0.05
187 0.06
188 0.07
189 0.07
190 0.07
191 0.06
192 0.07
193 0.08
194 0.09
195 0.09
196 0.09
197 0.11
198 0.15
199 0.16
200 0.19
201 0.22
202 0.24
203 0.26
204 0.32
205 0.35
206 0.33
207 0.38
208 0.36
209 0.35
210 0.33
211 0.33
212 0.29
213 0.26
214 0.26
215 0.22
216 0.22
217 0.21
218 0.22
219 0.21
220 0.2
221 0.18
222 0.16
223 0.15
224 0.15
225 0.14
226 0.12
227 0.1
228 0.1
229 0.11
230 0.11
231 0.1
232 0.07
233 0.08
234 0.08
235 0.09
236 0.09
237 0.08
238 0.1
239 0.17
240 0.18
241 0.21
242 0.22
243 0.27
244 0.32
245 0.37
246 0.4
247 0.36
248 0.4
249 0.39
250 0.45
251 0.39
252 0.34
253 0.29
254 0.25
255 0.24
256 0.19
257 0.18
258 0.11
259 0.1
260 0.1
261 0.1
262 0.09
263 0.07
264 0.07
265 0.06
266 0.06
267 0.06
268 0.07
269 0.08
270 0.09
271 0.09
272 0.09
273 0.08
274 0.09
275 0.1
276 0.09
277 0.1
278 0.07
279 0.08
280 0.08
281 0.07
282 0.06
283 0.05
284 0.06
285 0.06
286 0.06
287 0.06
288 0.07
289 0.07
290 0.08
291 0.1
292 0.12
293 0.12
294 0.12
295 0.13
296 0.11
297 0.14
298 0.14
299 0.15
300 0.12
301 0.12
302 0.12
303 0.12
304 0.14
305 0.14
306 0.16
307 0.14
308 0.15
309 0.14
310 0.14
311 0.13
312 0.12
313 0.11
314 0.11
315 0.11
316 0.1
317 0.11
318 0.11
319 0.13
320 0.16
321 0.16
322 0.15
323 0.16
324 0.17
325 0.24
326 0.29
327 0.28
328 0.24
329 0.23
330 0.22
331 0.23
332 0.23
333 0.15
334 0.12
335 0.17
336 0.17
337 0.17
338 0.17
339 0.15
340 0.14
341 0.14
342 0.13
343 0.1
344 0.1
345 0.15
346 0.18
347 0.23
348 0.24
349 0.27
350 0.28
351 0.31
352 0.38
353 0.43
354 0.47
355 0.49
356 0.5
357 0.5
358 0.47
359 0.47
360 0.41
361 0.32
362 0.24
363 0.19
364 0.2
365 0.19
366 0.2
367 0.21
368 0.25
369 0.29
370 0.39
371 0.48
372 0.52
373 0.6
374 0.65
375 0.68
376 0.71
377 0.77
378 0.77
379 0.77
380 0.77
381 0.76
382 0.76
383 0.68
384 0.64
385 0.6
386 0.54
387 0.47
388 0.42
389 0.35
390 0.3
391 0.3
392 0.26
393 0.21
394 0.19
395 0.16
396 0.19
397 0.21
398 0.23
399 0.25
400 0.31
401 0.34
402 0.41
403 0.43
404 0.4
405 0.39
406 0.41
407 0.39
408 0.37
409 0.35
410 0.34
411 0.33
412 0.34
413 0.34
414 0.3
415 0.31
416 0.32
417 0.37
418 0.35
419 0.41
420 0.41
421 0.44
422 0.48
423 0.47
424 0.43
425 0.36
426 0.37
427 0.31
428 0.32
429 0.29
430 0.26
431 0.26
432 0.26
433 0.25
434 0.22
435 0.25
436 0.21
437 0.22
438 0.21
439 0.2
440 0.21
441 0.21
442 0.22
443 0.18
444 0.17
445 0.15
446 0.17
447 0.18
448 0.23
449 0.25